KEGG   Shigella dysenteriae Sd197: SDY_0597Help
Entry
SDY_0597          CDS       T00306                                 

Gene name
yleA
Definition
hypothetical protein
Orthology
K06168  
bifunctional enzyme involved in thiolation and methylation of tRNA
Organism
sdy  Shigella dysenteriae Sd197
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(567017..568441)
Genome map
AA seq 474 aa AA seqDB search
MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVF
HQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRG
DRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDD
ILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSH
PIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDI
QISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQ
RLYILQERINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMIG
KFVDVEITDVYPNSLRGKVVRTEDEMGLRVAETPESVIARTRKENDLGVGYYQP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaactccatattaaaacctggggctgtcagatgaacgagtacgattcatcg
aagatggccgatctgctggatgccacccacggctatcaactgaccgacgtggcggaagaa
gcggatgtgctgctgctgaacacctgctcaatccgcgagaaggctcaggaaaaagtcttc
catcagttgggtcgctggaaactgttaaaagagaagaatccagacctgattatcggcgtc
ggtggctgcgtggcatcgcaagaaggcgagcacattcgccagcgcgcccactatgtcgat
attatttttgggccgcaaacgctgcaccgtctgccggagatgatcaactccgtgcgcggc
gaccgcagcccggttgtagatatcagcttcccggaaatcgagaagtttgaccgtctaccg
gaaccgcgcgccgaagggccgaccgcgtttgtctccatcatggaaggctgcaataaatat
tgcacctactgcgtggtgccttacacccgtggtgaagaggtaagccgtccgtccgacgat
attctgtttgagattgcccagcttgcggctcagggcgtgcgtgaagtcaacctgctcggt
cagaacgtgaacgcctggcgtggtgaaaactacgacggcaccaccggatcgtttgccgat
ctgttgcgtctggttgctgcgatcgacgggatcgatcgtattcgctttaccaccagccat
ccgatcgaattcaccgacgatatcatcgaagtgtatcgcgacacgccggagctggtgagc
ttcctgcatctgccggtacagagcggttccgatcgcattctgaacctgatgggacgtacc
catacggcgctggagtacaaagcgatcatccgtaaactgcgtgcggcgcgtccagatatt
cagatcagttctgatttcatcgttggcttccctggcgaaaccaccgaagacttcgagaaa
acgatgaagctgattgccgacgtcaatttcgacatgagctacagctttatcttctctgca
cgtccgggtacaccagccgccgatatggttgatgatgttccggaagaagagaagaagcag
cgtctgtatattctgcaagagcgcattaatcagcaagcgatggcatggagccgtcggatg
ctcggcaccacccagcgtattctggtagaagggacttcacgtaagagcatcatggagctt
tccgggcgtaccgaaaataatcgtgtggtcaacttcgagggcacaccggatatgatcggt
aaattcgtcgatgtagaaattaccgacgtctacccgaactctctgcgcggtaaagtggtg
cgaactgaagatgaaatgggtctgcgcgtggcagaaacaccggaatcggtgattgcccgt
actcgcaaagaaaacgaccttggtgtgggttattatcagccgtaa

DBGET integrated database retrieval system