KEGG   Shigella dysenteriae Sd197: SDY_0597Help
Entry
SDY_0597          CDS       T00306                                 

Gene name
yleA
Definition
hypothetical protein
Orthology
K06168  
bifunctional enzyme involved in thiolation and methylation of tRNA
Organism
sdy  Shigella dysenteriae Sd197
Brite
Transfer RNA biogenesis [BR:sdy03016]
 Prokaryotic Type
  tRNA modification factors
   Methylthiotransferase
    SDY_0597 (yleA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(567017..568441)
Genome map
AA seq 474 aa AA seqDB search
MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVF
HQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRG
DRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDD
ILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSH
PIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDI
QISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQ
RLYILQERINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMIG
KFVDVEITDVYPNSLRGKVVRTEDEMGLRVAETPESVIARTRKENDLGVGYYQP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaactccatattaaaacctggggctgtcagatgaacgagtacgattcatcg
aagatggccgatctgctggatgccacccacggctatcaactgaccgacgtggcggaagaa
gcggatgtgctgctgctgaacacctgctcaatccgcgagaaggctcaggaaaaagtcttc
catcagttgggtcgctggaaactgttaaaagagaagaatccagacctgattatcggcgtc
ggtggctgcgtggcatcgcaagaaggcgagcacattcgccagcgcgcccactatgtcgat
attatttttgggccgcaaacgctgcaccgtctgccggagatgatcaactccgtgcgcggc
gaccgcagcccggttgtagatatcagcttcccggaaatcgagaagtttgaccgtctaccg
gaaccgcgcgccgaagggccgaccgcgtttgtctccatcatggaaggctgcaataaatat
tgcacctactgcgtggtgccttacacccgtggtgaagaggtaagccgtccgtccgacgat
attctgtttgagattgcccagcttgcggctcagggcgtgcgtgaagtcaacctgctcggt
cagaacgtgaacgcctggcgtggtgaaaactacgacggcaccaccggatcgtttgccgat
ctgttgcgtctggttgctgcgatcgacgggatcgatcgtattcgctttaccaccagccat
ccgatcgaattcaccgacgatatcatcgaagtgtatcgcgacacgccggagctggtgagc
ttcctgcatctgccggtacagagcggttccgatcgcattctgaacctgatgggacgtacc
catacggcgctggagtacaaagcgatcatccgtaaactgcgtgcggcgcgtccagatatt
cagatcagttctgatttcatcgttggcttccctggcgaaaccaccgaagacttcgagaaa
acgatgaagctgattgccgacgtcaatttcgacatgagctacagctttatcttctctgca
cgtccgggtacaccagccgccgatatggttgatgatgttccggaagaagagaagaagcag
cgtctgtatattctgcaagagcgcattaatcagcaagcgatggcatggagccgtcggatg
ctcggcaccacccagcgtattctggtagaagggacttcacgtaagagcatcatggagctt
tccgggcgtaccgaaaataatcgtgtggtcaacttcgagggcacaccggatatgatcggt
aaattcgtcgatgtagaaattaccgacgtctacccgaactctctgcgcggtaaagtggtg
cgaactgaagatgaaatgggtctgcgcgtggcagaaacaccggaatcggtgattgcccgt
actcgcaaagaaaacgaccttggtgtgggttattatcagccgtaa

DBGET integrated database retrieval system