KEGG   Shigella dysenteriae Sd197: SDY_0702Help
Entry
SDY_0702          CDS       T00306                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDY_0702 (gpmA)
   01230 Biosynthesis of amino acids
    SDY_0702 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDY_0702 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SDY_0702 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDY_0702 (gpmA)
Enzymes [BR:sdy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDY_0702 (gpmA)
Exosome [BR:sdy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDY_0702 (gpmA)
  Exosomal proteins of melanoma cells
   SDY_0702 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(659398..660150)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEGILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgtgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactaagcgagaaagagctgccgctgactgaaagcctggcgctgactattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtaatc
atcgctgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagggattcttgagctgaatatcccgaccggcgtgccgctagtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system