KEGG   Shigella dysenteriae Sd197: SDY_1394Help
Entry
SDY_1394          CDS       T00306                                 

Definition
(RefSeq) endolysin
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
sdy  Shigella dysenteriae Sd197
Brite
Enzymes [BR:sdy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SDY_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme
Motif
Other DBs
NCBI-GeneID: 3799152
NCBI-ProteinID: YP_403030
ShiBASE_China: SDY1394
UniProt: Q32GL6
Position
1288402..1288935
Genome map
AA seq 177 aa AA seqDB search
MSRKFRYGLSAVVLALIAVGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDG
KPVVPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPSKCFT
STFYRKLNAGDRKGACAEIRRWIYDGGRDCRNRSNNCYGQVSRRDQESALACWSIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaaattccgctatggtttatcagcggtcgttctggcgctgattgctgtgggt
gcttctgcgcctgaaatcctcgaccagtttcttgacgaaaaagaaggtaaccataccacg
gcataccgtgatggtgcgggtatctggactatctgccgcggtgccatcttggtggatggc
aaacctgtcgttccgggcatgaagttgtcgaaggaaaaatgcgaccgggttaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcagagtgccactgactgaaccg
cagaaagcgggcatcgcgtcattctgcccgtacaacatcgggccttcgaaatgcttcacc
tcaacgttttaccggaaactgaacgccggagaccggaaaggtgcatgtgctgaaatccgc
cgatggatatatgacggcggcagggactgtcggaaccgctcaaataactgttacgggcag
gtatcgcggcgtgaccaggagagcgcgctggcgtgctggagtatcgacagataa

DBGET integrated database retrieval system