KEGG   Shigella dysenteriae Sd197: SDY_1394Help
Entry
SDY_1394          CDS       T00306                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sdy  Shigella dysenteriae Sd197
Brite
Enzymes [BR:sdy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SDY_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
1288402..1288935
Genome map
AA seq 177 aa AA seqDB search
MSRKFRYGLSAVVLALIAVGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDG
KPVVPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPSKCFT
STFYRKLNAGDRKGACAEIRRWIYDGGRDCRNRSNNCYGQVSRRDQESALACWSIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaaattccgctatggtttatcagcggtcgttctggcgctgattgctgtgggt
gcttctgcgcctgaaatcctcgaccagtttcttgacgaaaaagaaggtaaccataccacg
gcataccgtgatggtgcgggtatctggactatctgccgcggtgccatcttggtggatggc
aaacctgtcgttccgggcatgaagttgtcgaaggaaaaatgcgaccgggttaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcagagtgccactgactgaaccg
cagaaagcgggcatcgcgtcattctgcccgtacaacatcgggccttcgaaatgcttcacc
tcaacgttttaccggaaactgaacgccggagaccggaaaggtgcatgtgctgaaatccgc
cgatggatatatgacggcggcagggactgtcggaaccgctcaaataactgttacgggcag
gtatcgcggcgtgaccaggagagcgcgctggcgtgctggagtatcgacagataa

DBGET integrated database retrieval system