KEGG   Shigella dysenteriae Sd197: SDY_1487Help
Entry
SDY_1487          CDS       T00306                                 

Gene name
yeaD
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDY_1487 (yeaD)
Enzymes [BR:sdy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SDY_1487 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(1363381..1364286)
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPA
GEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQRGLPAHGFARNLPWTLKSHREDAN
GVALTFELTQSEETKKFWPHDFTLLAHFRVCKTCEIDLEAHGEFETTSALHTYFNVGDIA
KVSVSGLGNRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYTSEMQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaggtaaaagcctcttttgcattacagggcgcacaccttctctcgtggaaacctgcg
ggtgaagaagaagttctgtggttgagcaacaacacacctttcaaaaatggcgtcgctatt
cgcggtggcgtaccggtttgctggccgtggtttggtccggcggcacaacgaggcctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacatcgtgaagatgctaat
ggcgtagcgctgacttttgaattgacacaaagcgaagagacgaaaaaattctggccgcac
gactttactctgttagcgcatttccgcgtatgtaaaacctgtgaaatcgatcttgaagca
cacggcgaatttgaaaccacctctgccctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtgggctgggcaatcgcttcattgataaagtaaatgacgcgaaagaa
gatgtactgaccgacggtattcagaccttccctgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtgattaatgatgaagcgctgaatcgtattatcgccgtaggccac
cagcatcatctgaacgttgtaggctggaacccgggaccggcgctttcagttagcatgggc
gacatgccggacgatggctacaagacctttgtttgtgtagaaacagcttacacctcagaa
atgcaaaaagtgaccaaagaaaaacctgcacatctggcgcaatccattcgcgttgccaaa
cgttaa

DBGET integrated database retrieval system