KEGG   Shigella dysenteriae Sd197: SDY_1608Help
Entry
SDY_1608          CDS       T00306                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00010  Glycolysis / Gluconeogenesis
sdy00071  Fatty acid degradation
sdy00350  Tyrosine metabolism
sdy00625  Chloroalkane and chloroalkene degradation
sdy00626  Naphthalene degradation
sdy01100  Metabolic pathways
sdy01110  Biosynthesis of secondary metabolites
sdy01120  Microbial metabolism in diverse environments
sdy01130  Biosynthesis of antibiotics
sdy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDY_1608 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SDY_1608 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SDY_1608 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SDY_1608 (adhP)
   00626 Naphthalene degradation
    SDY_1608 (adhP)
Enzymes [BR:sdy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SDY_1608 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 BKACE Methyltransf_31 Phage_holin_2_1 DUF2284
Motif
Other DBs
NCBI-GeneID: 3796581
NCBI-ProteinID: YP_403226
ShiBASE_China: SDY1608
Position
complement(1470071..1471168)
Genome map
AA seq 365 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHDEALLKMECCGVCHTDLHVKNGDFGDKTSVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAQE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGHVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRRSEAFAATASPGVAASHTLQHEMAK
WIIVA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatgacgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccagcgtaattctgggccatgaaggg
attggtgtggtggcagaagtgggtccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcgcaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaagctgtcaaaaattcgt
cctgggcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcggtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggtgggcatgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgtcttgtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgccaggatttaactgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgctcagaggccttt
gctgcgactgccagtcctggtgtcgcagcatcgcacactctccaacatgaaatggctaaa
tggattattgttgcgtag

DBGET integrated database retrieval system