KEGG   Shigella dysenteriae Sd197: SDY_2207Help
Entry
SDY_2207          CDS       T00306                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SDY_2207 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SDY_2207 (rfbC)
Enzymes [BR:sdy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SDY_2207 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
2009705..2010262
Genome map
AA seq 185 aa AA seqDB search
MNVIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSTKGVLRG
LHYQLEPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWIGVNLSAENKRQLWIPEGFAHG
FLVLSETAEFVYKTTNYYNPSFEKSISYSDPTIKIQWPNLQDMHFKLSNKDLNAKNFFNN
NSLMQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaattaaaactgaaattccagatgtattaattttcgagccgaaagtttttggt
gatgaacgtggtttttttatggaaagctttaaccagaaagttttcgaagaggctgtaggg
cggaaggttgaatttgttcaggataaccattctaaatcaactaagggtgtgttacgcgga
ctgcactatcagttggaaccttatgctcaaggtaaattagttcgttgtgttgtcggtgaa
gtttttgatgtagcagttgatattcgtaaatcgtcacctacatttgggaaatggattggg
gtgaatttgtctgctgagaataagcgtcagttgtggatacctgaaggatttgcgcatgga
tttttggtgctgagtgaaacggctgagtttgtttataaaacaacaaactattacaatcca
agttttgaaaaaagtatttcatactcagatcctaccattaaaattcagtggcccaattta
caggatatgcattttaaattatcaaataaggatttgaatgctaagaacttttttaataac
aatagtttaatgcaatga

DBGET integrated database retrieval system