KEGG   Shigella dysenteriae Sd197: SDY_2221Help
Entry
SDY_2221          CDS       T00306                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00340  Histidine metabolism
sdy01100  Metabolic pathways
sdy01110  Biosynthesis of secondary metabolites
sdy01230  Biosynthesis of amino acids
Module
sdy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SDY_2221 (hisD)
Enzymes [BR:sdy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SDY_2221 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 3797499
NCBI-ProteinID: YP_403797
ShiBASE_China: SDY2221
UniProt: Q32EE9
Position
complement(2024418..2025722)
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISTSESITRTVNDILDNVKARGDEALREYSAKFDK
TTVTALTVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPAADMARRVAEAVERQLAELPRAETARQ
ALSASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARVLVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccacttctgaaagcattacccgcactgttaacgatattctc
gataacgtgaaagcacgcggcgatgaggccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcactgacggtgtctgctgaggaaattgccgccgctagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccggtcgcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgctgatgagatcctttacgcggcgcagctgtgcggtgtacaggac
gtgtttaacgtcggcggcgcacaggccattgccgcactggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgtcag
gtgagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactcacaggtgattttactgacgcccgctgctgatatggcgcgtcgc
gttgccgaggccgtcgaacgccagttggcagaactgccgcgtgccgaaaccgcccgccag
gcactgagcgccagccgcctgatcgtgactaaagatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgtactggtcgat
ggcattaccagtgccggttcggtatttcttggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgttctgccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaagcgcatgaccgtgcaggaactgtcgaaagaaggtttc
tccgcgctggcttcgaccattgaaacattggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system