KEGG   Shigella dysenteriae Sd197: SDY_2901Help
Entry
SDY_2901          CDS       T00306                                 

Gene name
srlB
Definition
PTS system glucitol/sorbitol-specific transporter subunit IIA
Orthology
K02781  
PTS system, glucitol/sorbitol-specific IIA component [EC:2.7.1.69]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
Fructose and mannose metabolism
Phosphotransferase system (PTS)
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sdy00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:sdy02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
2682083..2682454
Genome map
AA seq 123 aa AA seqDB search
MTVIYQTTITRIGASATDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSL
GQHSYPVTAVGSVAEDNLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGSVLKFES
VKE
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttatttatcagaccaccatcacccgtatcggcgcgagtgccactgacgccctc
agcgaccagatgctcatcacctttcgtgaaggcgcgccagcggacctcgaagagtattgc
ttcattcattgccacggcgagttgaaaggtgcactccatcccggtttgcaattttcactc
gggcagcatagctatccggtgaccgctgttggcagcgtggcggaagacaaccttcgcgaa
ctgggtcatgtcaccctgcgcttcgatggtttaaacgaagcggaatttccgggcactgtc
catgtggcaggccctgtgcccgacgatatcgcgccgggatcggttttgaagtttgaatct
gttaaggagtaa

DBGET integrated database retrieval system