KEGG   Shigella dysenteriae Sd197: SDY_2901Help
Entry
SDY_2901          CDS       T00306                                 

Gene name
srlB
Definition
PTS system glucitol/sorbitol-specific transporter subunit IIA
Orthology
K02781  
PTS system, glucitol/sorbitol-specific IIA component [EC:2.7.1.69]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
Fructose and mannose metabolism
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SDY_2901 (srlB)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SDY_2901 (srlB)
Enzymes [BR:sdy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     SDY_2901 (srlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
2682083..2682454
Genome map
AA seq 123 aa AA seqDB search
MTVIYQTTITRIGASATDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSL
GQHSYPVTAVGSVAEDNLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGSVLKFES
VKE
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttatttatcagaccaccatcacccgtatcggcgcgagtgccactgacgccctc
agcgaccagatgctcatcacctttcgtgaaggcgcgccagcggacctcgaagagtattgc
ttcattcattgccacggcgagttgaaaggtgcactccatcccggtttgcaattttcactc
gggcagcatagctatccggtgaccgctgttggcagcgtggcggaagacaaccttcgcgaa
ctgggtcatgtcaccctgcgcttcgatggtttaaacgaagcggaatttccgggcactgtc
catgtggcaggccctgtgcccgacgatatcgcgccgggatcggttttgaagtttgaatct
gttaaggagtaa

DBGET integrated database retrieval system