KEGG   Shigella dysenteriae Sd197: SDY_2912Help
Entry
SDY_2912          CDS       T00306                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sdy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
2694840..2696264
Genome map
AA seq 474 aa AA seqDB search
MSVFPQGFLWGGALAANQSEGAFREGGKGLTTVDMIPHGKHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDELTPNQQGIAFYRSVFKE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFINVQARGAYPAYSARVFREKGVTINKAPGDDEILK
NTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDEFAASGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVFVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccgcaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggcggcaaagggctgaccacggtcgatatgatcccgcacggcaag
catcgaatggcggtgaaactgggactggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagtcatgaggcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaagtgttccgtacctcaattgcctggagccgcctcttcccgcag
ggtgatgaactgacgcccaaccagcagggcattgctttttaccgttctgtctttaaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgccacttcgatgtgccgatgcat
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gcccggacctgctttgaagcatttgatggtctggtgaaatactggctaaccttcaatgaa
atcaacattatgttgcatagcccattctcaggcgcgggtctggtgtttgaagaaggtgaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagctgcaaaccggaagatgtctgggcggcgctggagaaagatcgg
gaaaacctgttttttatcaatgtgcaggcgcgcggcgcgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcaacaaagcaccgggcgatgatgaaatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaacagcagtgcggcgaacgtggtgaaatcgctgcgtaacccgtatctgcaa
gtgagcgactggggctggggaattgatccactcggtctgcgtatcaccatgaacatgatg
tacgaccgctatcagaagccgctgtttctggtggaaaacggcctcggcgcaaaagatgaa
tttgctgccagtggcgagattaacgatgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagacggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctctacgggtgaaatgagcaaacgctacggttttgtcttt
gttgaccgtgacgacgcaggcaacggcacgctgacgcgcacacgtaagaaatcgttctgg
tggtataaaaaagtgattgccagtaatggtgaagatttagagtaa

DBGET integrated database retrieval system