KEGG   Shigella dysenteriae Sd197: SDY_3742Help
Entry
SDY_3742          CDS       T00306                                 

Gene name
rplL
Definition
50S ribosomal protein L7/L12
Orthology
K02935  
large subunit ribosomal protein L7/L12
Organism
sdy  Shigella dysenteriae Sd197
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SDY_3742 (rplL)
Ribosome [BR:sdy03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    SDY_3742 (rplL)
  Bacteria
    SDY_3742 (rplL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(3477743..3478108)
Genome map
AA seq 121 aa AA seqDB search
MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILK
AAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEV
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcactaaagatcaaatcattgaagcagttgcagctatgtctgtaatggacgtt
gtagaactgatctctgcaatggaagaaaaattcggtgtttccgctgctgctgctgtagct
gtagctgctggcccggttgaagctgctgaagaaaaaactgaattcgacgtaattctgaaa
gctgctggcgctaacaaagttgctgttatcaaagcagtacgtggcgcaactggcctgggt
ctgaaagaagctaaagacctggtagaatctgcaccggctgctctgaaagaaggcgtgagc
aaagacgacgcagaagcactgaaaaaagctctggaagaagctggcgctgaagttgaagtt
aaatag

DBGET integrated database retrieval system