KEGG   Shigella dysenteriae Sd197: SDY_3899Help
Entry
SDY_3899          CDS       T00306                                 

Gene name
fadB
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00071  Fatty acid degradation
sdy00280  Valine, leucine and isoleucine degradation
sdy00281  Geraniol degradation
sdy00310  Lysine degradation
sdy00362  Benzoate degradation
sdy00380  Tryptophan metabolism
sdy00410  beta-Alanine metabolism
sdy00640  Propanoate metabolism
sdy00650  Butanoate metabolism
sdy00903  Limonene and pinene degradation
sdy00930  Caprolactam degradation
sdy01040  Biosynthesis of unsaturated fatty acids
sdy01100  Metabolic pathways
sdy01110  Biosynthesis of secondary metabolites
sdy01120  Microbial metabolism in diverse environments
sdy01130  Biosynthesis of antibiotics
sdy01200  Carbon metabolism
sdy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SDY_3899 (fadB)
   00650 Butanoate metabolism
    SDY_3899 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SDY_3899 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SDY_3899 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SDY_3899 (fadB)
   00310 Lysine degradation
    SDY_3899 (fadB)
   00380 Tryptophan metabolism
    SDY_3899 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SDY_3899 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SDY_3899 (fadB)
   00281 Geraniol degradation
    SDY_3899 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SDY_3899 (fadB)
   00930 Caprolactam degradation
    SDY_3899 (fadB)
Enzymes [BR:sdy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SDY_3899 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SDY_3899 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SDY_3899 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     SDY_3899 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 3797015
NCBI-ProteinID: YP_405325
ShiBASE_China: SDY3899
UniProt: Q32A21
Position
3629491..3631680
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPSSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALIGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWHYKEDSKGKP
KKEEDAAVDDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaagttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaatggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattaccgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactgattgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcgaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagctaccatgagcttcaccatcgctaaagggatggtc
gcacaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagctctaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagctcgcgcactgatcggcatattccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgctgtgctgggc
gcaggcattatgggcggcggcatcgcttaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctctaca
atccacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gtcgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgagcagaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgtccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatgccgttg
gtggaaattattcgcggcgagaaaagctccgacgaaactattgcgaaagtcgtcgcctgg
gcgagcaagatgggtaaaacgccgattgtggttaacgattgccccggcttcttcgtcaac
cgcgtgctgttcccgtatttcgccggtttcagccagttgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggcctatgggtccggcatatcta
ctggacgttgtgggcattgacaccgcgcatcacgcccaggcagtcatggcagcgggcttc
ccacagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcattataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgctgttgacgacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggcagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtacgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system