KEGG   Shigella dysenteriae Sd197: SDY_4631Help
Entry
SDY_4631          CDS       T00306                                 

Gene name
holD
Definition
(RefSeq) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00230  Purine metabolism
sdy00240  Pyrimidine metabolism
sdy01100  Metabolic pathways
sdy03030  DNA replication
sdy03430  Mismatch repair
sdy03440  Homologous recombination
Module
sdy_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SDY_4631 (holD)
   00240 Pyrimidine metabolism
    SDY_4631 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SDY_4631 (holD)
   03430 Mismatch repair
    SDY_4631 (holD)
   03440 Homologous recombination
    SDY_4631 (holD)
Enzymes [BR:sdy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SDY_4631 (holD)
DNA replication proteins [BR:sdy03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SDY_4631 (holD)
DNA repair and recombination proteins [BR:sdy03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SDY_4631 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-GeneID: 3795386
NCBI-ProteinID: YP_405971
ShiBASE_China: SDY4631
UniProt: Q327M5
Position
4335165..4335578
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgaccgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgaattacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system