KEGG   Shigella dysenteriae 1617: Asd1617_00463Help
Entry
Asd1617_00463     CDS       T02933                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sdz  Shigella dysenteriae 1617
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Asd1617_00463
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Asd1617_00463
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Asd1617_00463
Enzymes [BR:sdz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Asd1617_00463
Exosome [BR:sdz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Asd1617_00463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(342229..342666)
Genome map
AA seq 145 aa AA seqDB search
MAGKTLREQAQARGYQLVSDATSLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNI
DKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFCKLKVRQSINRIMLRILVGKL
ARRSISMKPYNGRWNSLKRRVTRWS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaaaacactgcgtgaacaggcacaggcgcgtggttatcagttggtgagcgat
gctacctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctgttt
gctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtatcacggtaatatt
gataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccaaccctg
gcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttctgc
aagttgaaggtgcgtcaatcgataaacaggatcatgttgcgaatccttgtgggcaaattg
gcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaaggagg
gtaacacgttggtcatag

DBGET integrated database retrieval system