KEGG   Shigella dysenteriae 1617: Asd1617_02167Help
Entry
Asd1617_02167     CDS       T02933                                 

Definition
Glutamate decarboxylase (EC:4.1.1.15)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
sdz  Shigella dysenteriae 1617
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Asd1617_02167
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Asd1617_02167
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Asd1617_02167
   00430 Taurine and hypotaurine metabolism
    Asd1617_02167
Enzymes [BR:sdz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Asd1617_02167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1454572..1455807)
Genome map
AA seq 411 aa AA seqDB search
MEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIG
VVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDWDV
ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTG
IDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEAL
PQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLAD
EITKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEA
TDLVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcaggcaaaccaacggataaaccaaacctggtgtgcggtccggtgcaaatc
tgctggcataaattcgctcgctactgggatgtggagctgcgtgagatccctatgcgcccc
ggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaaaacaccatcggc
gtggtgccgactttcggcgtgacctacaccggtaactatgagttcccgcaaccgctgcac
gatgcactggataaattccaggccgacaccggtatcgacatcgacatgcacatcgacgct
gctagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgggactgggatgtg
gagctgcgtgagatccctatgcgccccggtcagttgtttatggatccgaaacgcatgatt
gaagcctgcgacgaaaacaccatcggcgtggtgccgactttcggcgtgacctacaccggt
aactatgagttcccgcaaccgctgcacgatgcgctggataaattccaggccgacaccggt
atcgacatcgacatgcacatcgacgctgctagcggtggcttcctggcaccgttcgtcgcc
ccggatatcgtctgggacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccac
aaattcggtctggctccgctgggctgcggctgggttatctggcgtgatgaagaagcgctg
ccgcaggaactggtgttcaacgttgactacctcggtggtcagattggtactttcgccatc
aacttctcccgcccggcgggtcaggtaattgcacagtactatgaattcctgcgcctcggt
cgtgaaggctataccaaagtacagaacgcctcttaccaggttgccgcttatctggcggat
gaaatcaccaaactggggccgtatgagttcatctgtaccggtcgcccggacgaaggcatt
ccagcggtttgcttcaaactcaaagatggtgaagatccgggatacaccctgtatgacctc
tctgaacgtctgcgtctgcgcggctggcaggttccggccttcactctcggcggtgaagcc
accgacctcgtggtgatgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaa
ctgttgctggaagactacaaagcctccctgaaatatctcagcgatcacccgaaactgcag
ggtattgcccaacagaacagctttaaacatacctga

DBGET integrated database retrieval system