KEGG   Shigella dysenteriae 1617: Asd1617_03353Help
Entry
Asd1617_03353     CDS       T02933                                 

Definition
(GenBank) Aminotransferase yfbQ
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdz  Shigella dysenteriae 1617
Pathway
sdz00220  Arginine biosynthesis
sdz00250  Alanine, aspartate and glutamate metabolism
sdz00290  Valine, leucine and isoleucine biosynthesis
sdz01100  Metabolic pathways
sdz01110  Biosynthesis of secondary metabolites
sdz01130  Biosynthesis of antibiotics
sdz01210  2-Oxocarboxylic acid metabolism
sdz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Asd1617_03353
   00290 Valine, leucine and isoleucine biosynthesis
    Asd1617_03353
   00220 Arginine biosynthesis
    Asd1617_03353
Enzymes [BR:sdz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Asd1617_03353
    2.6.1.66  valine---pyruvate transaminase
     Asd1617_03353
Amino acid related enzymes [BR:sdz01007]
 Aminotransferase (transaminase)
  Class I
   Asd1617_03353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AHA66180
UniProt: A0A0A6ZW72
Position
2242450..2243697
Genome map
AA seq 415 aa AA seqDB search
MAITAKRSRFMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDA
PDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQ
AMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTR
GIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIATLAPDL
LTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTAL
GGYQSISEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQK
MVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggcgataacagcaaaaaggtcaagattcatgtcccccattgaaaaatccagcaaatta
gagaatgtctgttatgacattcgtggtccggtgctgaaagaagcaaaacgcctggaagaa
gaaggtaacaaggtactgaaactgaacatcggcaacccagccccgttcggttttgacgcg
ccagatgaaatcctcgttgacgtgatacgcaacctgcctacagctcaagggtattgcgat
tccaaaggtctttactccgcgcgtaaagccatcatgcagcactaccaggctcgtggcatg
cgtgatgttaccgtggaagatatttacatcggcaatggtgtatcggagcttatcgttcag
gcaatgcaggcattgctgaacagcggggacgaaatgttggttcctgcaccagattaccca
ctatggaccgcggcggtttcgctttccagcggtaaagcggtgcattatctttgcgatgaa
tcctctgactggttcccggacctcgatgatattcgcgctaaaattacgcctcgtacgcgt
gggatcgttattatcaacccaaataacccaaccggcgcggtatattccaaagagctttta
atggagattgtggagattgcacgtcagcataatctcattatcttcgccgatgaaatttat
gacaaaattctctacgacgacgctgagcatcactcaattgcgacgctggcacctgacctg
ctgaccattacctttaatggactgtcgaaaacgtaccgcgttgcaggcttccgtcagggg
tggatggtgttgaacgggccgaaaaaacacgccaaaggctacatcgaaggtctggaaatg
ctggcttcaatgcgcctgtgtgctaacgttcctgcgcaacacgccattcagaccgcgctg
ggtggttatcagagcatcagtgaatttattacccctggcggtcgtctttatgagcagcgt
aaccgcgcgtgggaattgatcaacgatattccgggcgtttcctgcgtgaaacctcgtggt
gcgctgtacatgttcccgaaaatcgacgccaaacgctttaacattcacgacgatcagaaa
atggtgctggatttcctgttgcaggaaaaagttctgttggtgcaagggacggcattcaac
tggccgtggccggatcacttccgcattgtcacgctaccgcgtgtcgatgatatcgagctg
tctttgagcaagttcgcgcgtttcctttctggttatcatcagctgtaa

DBGET integrated database retrieval system