KEGG   Shigella dysenteriae 1617: Asd1617_03353Help
Entry
Asd1617_03353     CDS       T02933                                 

Definition
Aminotransferase yfbQ (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdz  Shigella dysenteriae 1617
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Asd1617_03353
   01230 Biosynthesis of amino acids
    Asd1617_03353
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Asd1617_03353
   00290 Valine, leucine and isoleucine biosynthesis
    Asd1617_03353
Enzymes [BR:sdz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Asd1617_03353
    2.6.1.66  valine---pyruvate transaminase
     Asd1617_03353
Amino acid related enzymes [BR:sdz01007]
 Aminotransferase (transaminase)
  Class I
   Asd1617_03353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2242450..2243697
Genome map
AA seq 415 aa AA seqDB search
MAITAKRSRFMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDA
PDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQ
AMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTR
GIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIATLAPDL
LTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTAL
GGYQSISEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQK
MVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggcgataacagcaaaaaggtcaagattcatgtcccccattgaaaaatccagcaaatta
gagaatgtctgttatgacattcgtggtccggtgctgaaagaagcaaaacgcctggaagaa
gaaggtaacaaggtactgaaactgaacatcggcaacccagccccgttcggttttgacgcg
ccagatgaaatcctcgttgacgtgatacgcaacctgcctacagctcaagggtattgcgat
tccaaaggtctttactccgcgcgtaaagccatcatgcagcactaccaggctcgtggcatg
cgtgatgttaccgtggaagatatttacatcggcaatggtgtatcggagcttatcgttcag
gcaatgcaggcattgctgaacagcggggacgaaatgttggttcctgcaccagattaccca
ctatggaccgcggcggtttcgctttccagcggtaaagcggtgcattatctttgcgatgaa
tcctctgactggttcccggacctcgatgatattcgcgctaaaattacgcctcgtacgcgt
gggatcgttattatcaacccaaataacccaaccggcgcggtatattccaaagagctttta
atggagattgtggagattgcacgtcagcataatctcattatcttcgccgatgaaatttat
gacaaaattctctacgacgacgctgagcatcactcaattgcgacgctggcacctgacctg
ctgaccattacctttaatggactgtcgaaaacgtaccgcgttgcaggcttccgtcagggg
tggatggtgttgaacgggccgaaaaaacacgccaaaggctacatcgaaggtctggaaatg
ctggcttcaatgcgcctgtgtgctaacgttcctgcgcaacacgccattcagaccgcgctg
ggtggttatcagagcatcagtgaatttattacccctggcggtcgtctttatgagcagcgt
aaccgcgcgtgggaattgatcaacgatattccgggcgtttcctgcgtgaaacctcgtggt
gcgctgtacatgttcccgaaaatcgacgccaaacgctttaacattcacgacgatcagaaa
atggtgctggatttcctgttgcaggaaaaagttctgttggtgcaagggacggcattcaac
tggccgtggccggatcacttccgcattgtcacgctaccgcgtgtcgatgatatcgagctg
tctttgagcaagttcgcgcgtttcctttctggttatcatcagctgtaa

DBGET integrated database retrieval system