KEGG   Shigella dysenteriae 1617: Asd1617_03831Help
Entry
Asd1617_03831     CDS       T02933                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sdz  Shigella dysenteriae 1617
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Asd1617_03831
   00650 Butanoate metabolism
    Asd1617_03831
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Asd1617_03831
   00280 Valine, leucine and isoleucine degradation
    Asd1617_03831
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Asd1617_03831
Enzymes [BR:sdz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Asd1617_03831
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Asd1617_03831
Amino acid related enzymes [BR:sdz01007]
 Aminotransferase (transaminase)
  Class III
   Asd1617_03831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2593601..2594044
Genome map
AA seq 147 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGRITGARITRWR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcagttcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccaggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgctgccaccaaacgtagcggcaccatcgcttttagcggccgtatcacgggc
gcacgcattacacgctggcgctga

DBGET integrated database retrieval system