KEGG   Shigella dysenteriae 1617: Asd1617_04898Help
Entry
Asd1617_04898     CDS       T02933                                 

Definition
Glucan 1,4-alpha-maltohexaosidase precursor (EC:3.2.1.98)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sdz  Shigella dysenteriae 1617
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Asd1617_04898
Enzymes [BR:sdz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Asd1617_04898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3387873..3388424)
Genome map
AA seq 183 aa AA seqDB search
MSLAFLPDIKTESTTASGLPVFYKNKTDTHAKVIEGFTPRDYLTHWLSQWVRDHGIDGFR
VDTAKHVELPAWQQLKTEASAALREWKKANPDKALDDKPFWMTGEAWGHCVMQSDYYRHG
FDAMINFDYQEQAAKAVDCLAQMDTTWQQIAEKLQGFNVLSYLSSHDTRLFREGATKQQS
YYY
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctggcctttttgccggatatcaaaaccgaatcaactaccgcttctggtctgccg
gtgttctataaaaacaaaacggatactcacgctaaagtcatcgaaggctttacacctcgc
gattacttaacccactggttaagtcagtgggtccgcgaccatgggattgatggttttcgg
gtcgataccgccaaacatgttgagttgcccgcctggcagcaactgaaaaccgaagccagc
gccgcgcttcgcgaatggaaaaaagctaaccccgacaaagcattagatgacaaacctttc
tggatgaccggtgaagcctggggccactgcgtgatgcaaagtgactactatcgccacggc
ttcgatgcgatgatcaatttcgattatcaggagcaggcggcgaaagcagtcgattgtctg
gcgcagatggatacgacctggcagcaaatagcggagaaattgcagggtttcaacgtgttg
agctacctctcgtcgcatgatacccgcctgttccgtgaaggggcgacaaagcagcagagt
tattactattag

DBGET integrated database retrieval system