KEGG   Shigella dysenteriae 1617: Asd1617_05225Help
Entry
Asd1617_05225     CDS       T02933                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sdz  Shigella dysenteriae 1617
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asd1617_05225
Enzymes [BR:sdz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Asd1617_05225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3676468..3677424)
Genome map
AA seq 318 aa AA seqDB search
MAHFMDIPNMQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAA
GRSGANIAFIACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIG
IHAGANAALSPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPALAR
ELPDELLALVNIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWA
SVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGA
QPSVPWREEIDAFLDRQR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcattttatggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggc
agcattaatgctgaccacattcttaatcttcaatcttttcctactccaggcgaaaccgta
accggtaaccactatcaggttgcatttggcggcaaaggcgcgaatcaggctgtggctgct
gggcgtagcggtgcgaatatcgcgtttattgcctgtactggcgatgacagcattggcgag
agcgttcgccagcagctcgccactgataacatcgatattactccggtcagcgtgatcaaa
ggcgaatcaacaggtgtggcgctgatttttgttaatggcgaaggtgagaatgtcattggt
attcatgccggcgctaatgctgccctttccccggcgctggtggaagcgcaacgtgagcgt
attgccaacgcgtcagcattattaatgcagctggaatcaccactcgaaagtgtgatggca
gcggcgaaaatcgcccatcaaaataagactatcgttgcgcttaacccggctctggctcgc
gaacttcctgacgaactgctggcgctggtgaacattattacgccaaacgaaacggaagca
gaaaagctcaccggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggta
ctgcatgaaaaaggtatccgtactgtactgattactttaggaagtcgtggtgtatgggct
agcgtgaatggtgaaggtcagcgcgttcctggattccgggtgcaggctgtcgataccatt
gctgccggagatacctttaacggcgcgttaatcacggcgttgctggaagaaaaaccattg
ccagaggcgattcggtttgcccatgctgccgctgcgattgccgtaacacgtaaaggcgca
caaccttccgtaccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system