KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B0096Help
Entry
SeAg_B0096        CDS       T00751                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sea00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sea00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
100796..101275
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
VISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc
gtcatgggacgtcacacctgggagtccatcggacgccccttaccgggacgtaaaaatatt
gttatcagcagccagccgggcaccgacgatcgcgtgcagtgggtgaagtctgtcgatgag
gcgattgccgcttgcggcgatgcgccggaaattatggtcattggcggcgggcgcgtgtac
gagcagttcttgccaaaggcgcagaagctttatctgacgcatattgatgcggaagtcgaa
ggcgatacccattttccggattatgaaccggatgactgggaatcggtattcagtgagttt
cacgatgccgacgcgcagaattctcacagctattgtttcgagattctggaacgtcgttaa

DBGET integrated database retrieval system