KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B0097Help
Entry
SeAg_B0097        CDS       T00751                                 

Gene name
apaH
Definition
diadenosine tetraphosphatase (EC:3.6.1.41)
Orthology
K01525  
bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC:3.6.1.41]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SeAg_B0097 (apaH)
Enzymes [BR:sea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.41  bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
     SeAg_B0097 (apaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(101381..102229)
Genome map
AA seq 282 aa AA seqDB search
MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVKSLGNSVR
LVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRRQPLLQVDEEKKLVMAH
AGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNWSPELSGLARLRFITNAF
TRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVSEAYSIAFGHWASLEGKGTPEGI
YALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGEGEAVNA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttatctcatcggcgacgttcacggttgctacgacgaactgatcgccttatta
cagcaagtggaatttacgccagatacagacactctgtggctgactggcgatttggtcgcc
cgcggtcccggttcgctggacgtgttacgctacgtcaaatcgcttggcaatagcgtgcgt
ttggtgctggggaatcacgatttacacctgttggccgtattcgccgggattagccgcaac
aaacctaaagaccggctgaccccgcttcttgaagcgccggacgccgatgagctgttgaat
tggttacgccgtcagccgctgttgcaggtagatgaagagaaaaagctggtcatggcgcat
gcgggtattactccgcagtgggatttgcagacggcaaaagagtgcgcccgcgatgttgaa
gcggtgctgtcgagcgactcgtacccgtttttcctcgacgcgatgtatggcgatatgccg
aataactggtcgccggagttaagcggtctggcgcggctacgctttattactaatgccttt
acccgtatgcgttactgctttcctaacggtcaactggatatgtacagcaaagcgtcgccg
gaaaatgcccctgcgccgttgaagccgtggttcgccattccggggccggtgagcgaggct
tacagtattgcgttcgggcactgggcgtctctggaagggaaagggacgccggaaggtatt
tacgcgctggataccggctgctgctggggcggggagttgacctgtttacgctgggaagat
aaacagtattttgtgcagccgtcaaaccgccagatggatatgggcgaaggcgaagcggtc
aacgcctga

DBGET integrated database retrieval system