KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B0356Help
Entry
SeAg_B0356        CDS       T00751                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00330  Arginine and proline metabolism
sea00332  Carbapenem biosynthesis
sea01100  Metabolic pathways
sea01130  Biosynthesis of antibiotics
sea01230  Biosynthesis of amino acids
Module
sea_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SeAg_B0356 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SeAg_B0356 (proB)
Enzymes [BR:sea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SeAg_B0356 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACH52288
UniProt: B5EWK5
Position
348917..350020
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAMLERGSSLLPKGI
KSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtcgtaaaactcggcaccagcgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgtagaacttgtccgccagtgcgcgcagctacacgcc
gcgggacatcgtattgttattgttacctctggcgcgattgccgccggacgtgaacatctc
ggctacccggaactgccggcaacgatcgcctctaaacagcttctggcggcggtagggcaa
agccgtctgattcaactgtgggagcagttgttttcaatttacggtatccatatcgggcag
atgctgttgacgcgtgcggatatggaagacagagagcgctttctgaacgcccgcgatacg
ctgcgtgcattactggataaccatattgtgccggttatcaatgaaaatgatgccgttgcg
acagcggaaattaaagtgggcgataacgataacctctccgcgctggcggcgatcctggca
ggcgcggataaactgctgctgctgaccgatcagcaaggattatttaccgccgatccgcgt
agcaatccgcaggcggagcttatcaaagatgtgtatggcgttgacgatgcgctgcgctct
atcgcgggagacagcgtttccgggctgggaaccggtggtatgagcactaagcttcaggcg
gcagacgtggcctgtcgcgcgggtattgatacaattattgcctcaggcagtaaaccgggc
gtgatcggcgatgtgatggaggggatttccgtcggcacccgttttcatgcgcaagcctcg
ccgctggagaaccgcaaacgttggatcttcggcgcgccgccggcaggcgaaattacggtt
gatgaaggcgcgaccgcggcaatgctggaacgtggcagttcacttctgccaaaaggcatc
aaaagcgtgacgggcaatttctcgcggggggaggtcatcagaatttgtaacctgcaaggg
cgtgatatcgctcatggcgtcagccgttataacagtgatgctctgcggcggatagccggt
caccactctcaacaaatcgatgcgattcttggctatgaatatggcccggtcgctgttcat
cgtgatgacatgattactcgataa

DBGET integrated database retrieval system