KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B0531Help
Entry
SeAg_B0531        CDS       T00751                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sea00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeAg_B0531 (recR)
DNA repair and recombination proteins [BR:sea03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SeAg_B0531 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
526082..526687
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgttaactcagcttatggaagcgttgcgctgccttccgggcgtc
ggccctaagtcggcgcagcggatggcgtttaccctgttgcagcgcgatcgcagcggcgga
atgcgtctggcgcaggcgctgacccgggcgatgtcggaaatcggccactgcgccgactgc
cgcacctttaccgagcaggatgtttgtaatatctgttcgaacccgcggcgtcaggaaaac
ggccagatttgcgtggtggagagtcctgcggatatctacgccattgagcagaccgggcaa
ttttccgggcggtatttcgtgctgatgggccacctgtcgccgctggacggcatcgggccg
gatgatatcggtctcgatcgtctggaacagcggctggcgtcagaaaaaatcagtgagctg
atcctcgcgaccaacccgacggttgaaggggaggctaccgcgaactatattgccgagctg
tgcgcggaggccggcgtcgaagccagtcgtatcgcccacggcgtgccggttggcggcgaa
ctggagatggtcgacggtacgacgctgtcccactcgctggcgggacgtcataagattatt
ttctga

DBGET integrated database retrieval system