KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1167Help
Entry
SeAg_B1167        CDS       T00751                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SeAg_B1167
Enzymes [BR:sea01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SeAg_B1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1161564..1162550
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLELIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQC
EEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAG
QLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGIS
QKRFNDDGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgctttcctcgcctggagcttattggcgcgccgaccccg
ctcgaatacctgccgcgattgtctgattatcttggccgtgagatttacattaagcgcgat
gacgttacgcccattgcaatgggcggcaataaactgcgcaagctggagtttctggtggcc
gacgcgctgcgagaaggggcggatacgctgataaccgcaggggcgattcagtcgaaccat
gtccgtcagacggcggcggtcgcggccaaattgggactacattgcgtcgccttgctggaa
aatccaatcggtaccaccgcggaaaattacctgacgaatggtaatcgcctgttactggat
ttatttaatacgcaaattgagatgtgcgatgcgctaaccgatccggatgcgcagctgcaa
acgctggcgacgcgcattgaagcgcaagggttcaggccctatgtgattccggtcggcggc
tccagcgcgctgggcgcaatgggatacgtagagagcgccctggaaatcgcccagcagtgt
gaagaagtcgtcgggctctcttcggtggtggtggcctccggcagcgccggaacgcacgcc
gggttagctgtcgggctggaacatctgatgccggatgtcgaactgattggcgtgaccgtt
tcacgttctgtcgccgagcagaaacccaaagtgattgccttacagcaggctattgccggt
cagctggcgctgacggcgacggcggatattcatttatgggatgactattttgccccgggt
tacggcgtgccaaatgacgcggggatggaggcggtgaaactgctggcgagcctggagggg
gtgctactggatccggtatataccggtaaagcgatggcgggtctgatagacggcatcagc
cagaaacgctttaacgatgacgggccgattctctttattcacaccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system