KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1229Help
Entry
SeAg_B1229        CDS       T00751                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sea03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1213918..1214529
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacccccgatcgtgctgctggag
acagggggcgtaggctatgaagtacatatgcctatgacctgcttttacgagctgccggag
gccgggcaggaggcaatcgtcttcacccactttgtggtgcgtgaagatgcgcagttgctg
tacggattcaacaataagcaagagcgcacgctgtttaaagagctaattaaaacgaatggc
gtcgggcctaagctggcgctggcgatcctctccggcatgtcggcgcagcagtttgtgaat
gcggttgagcgcgaagagcttggcgcactggtgaagctgccgggtatcggcaagaaaacc
gccgaaaggctgattgtcgaaatgaaagaccgctttaaagggctacatggcgatctcttt
acgccagcggtcgatctggtattgacgtcgccggccagcccaacctcggaagatgcagaa
caagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaagccagtcggatg
gtaagcaagatcgcccgtccggatgcaagcagtgaaacactgattcgcgacgcgttacgc
gccgcgttatga

DBGET integrated database retrieval system