KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1230Help
Entry
SeAg_B1230        CDS       T00751                                 

Gene name
ruvB
Definition
Holliday junction DNA helicase RuvB (EC:3.6.1.-)
Orthology
K03551  
holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sea00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeAg_B1230 (ruvB)
Enzymes [BR:sea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SeAg_B1230 (ruvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1214538..1215548
Genome map
AA seq 336 aa AA seqDB search
MIEADRLISAGATIAEDVADRAIRPKLLAEYVGQPQVRSQMEIFIQAAKRRGDALDHLLI
FGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQR
LEFYQVPDLQHIVGRSARHMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDG
AISAEIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDV
LEPYLIQQGFLQRTPRGRMATVRAWNHFGITPPEMP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagcagatcgcctgatttcagcaggcgccacgatcgcagaagacgtcgccgat
cgcgccattcgcccgaagttattggcggaatatgtcggccaaccgcaggtgcgctcccag
atggagatctttattcaggcggcaaaacggcgtggcgacgcactagatcacttgctgatt
ttcggcccgccagggttaggtaagacgactctggcgaatatcgttgccaatgaaatgggc
gtcaatctccgaaccacgtccggcccggtgctggaaaaagcaggcgatctggcggctatg
ctcaccaatcttgaaccgcatgatgtgctgtttattgatgagattcaccggctttcaccg
gtggtggaagaggtactctatccggcgatggaagattaccagttggatattatgattggc
gaagggcctgctgcacgttcaattaagatcgatctgccgccgtttacgctcattggcgcg
acgacgcgagcaggttcgctgacctcgccgctacgtgaccgttttggtattgtgcagcgc
ctggagttctaccaggtgcccgatctgcagcacatcgtcgggcgcagcgcaaggcacatg
gggcttgagatgagtgatgacggcgcgctggaagtggcgcgtcgggcgcgcggtacgccg
cgtatagccaaccgcctgctcagacgtgtgcgtgatttcgccgaggtgaagcatgacggg
gctatttcagcggaaattgccgcgcaggcgctggatatgctgaacgtcgatgcggaaggg
tttgactatatggatcgcaagctgctgctggcggttattgataaattcttcggtggtccg
gtgggactggataacctggcggcggcgattggcgaagagcgtgaaaccattgaggatgtg
ctggagccgtatctgattcagcaaggctttttgcagcgtacgccgcgtgggcgtatggca
acggtgcgcgcctggaaccatttcgggatcacgccgccagagatgccttag

  All links  
No link information was found.   
DBGET integrated database retrieval system