KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1230Help
Entry
SeAg_B1230        CDS       T00751                                 

Gene name
ruvB
Definition
Holliday junction DNA helicase RuvB (EC:3.6.1.-)
Orthology
K03551  
holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sea03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1214538..1215548
Genome map
AA seq 336 aa AA seqDB search
MIEADRLISAGATIAEDVADRAIRPKLLAEYVGQPQVRSQMEIFIQAAKRRGDALDHLLI
FGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQR
LEFYQVPDLQHIVGRSARHMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDG
AISAEIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDV
LEPYLIQQGFLQRTPRGRMATVRAWNHFGITPPEMP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagcagatcgcctgatttcagcaggcgccacgatcgcagaagacgtcgccgat
cgcgccattcgcccgaagttattggcggaatatgtcggccaaccgcaggtgcgctcccag
atggagatctttattcaggcggcaaaacggcgtggcgacgcactagatcacttgctgatt
ttcggcccgccagggttaggtaagacgactctggcgaatatcgttgccaatgaaatgggc
gtcaatctccgaaccacgtccggcccggtgctggaaaaagcaggcgatctggcggctatg
ctcaccaatcttgaaccgcatgatgtgctgtttattgatgagattcaccggctttcaccg
gtggtggaagaggtactctatccggcgatggaagattaccagttggatattatgattggc
gaagggcctgctgcacgttcaattaagatcgatctgccgccgtttacgctcattggcgcg
acgacgcgagcaggttcgctgacctcgccgctacgtgaccgttttggtattgtgcagcgc
ctggagttctaccaggtgcccgatctgcagcacatcgtcgggcgcagcgcaaggcacatg
gggcttgagatgagtgatgacggcgcgctggaagtggcgcgtcgggcgcgcggtacgccg
cgtatagccaaccgcctgctcagacgtgtgcgtgatttcgccgaggtgaagcatgacggg
gctatttcagcggaaattgccgcgcaggcgctggatatgctgaacgtcgatgcggaaggg
tttgactatatggatcgcaagctgctgctggcggttattgataaattcttcggtggtccg
gtgggactggataacctggcggcggcgattggcgaagagcgtgaaaccattgaggatgtg
ctggagccgtatctgattcagcaaggctttttgcagcgtacgccgcgtgggcgtatggca
acggtgcgcgcctggaaccatttcgggatcacgccgccagagatgccttag

DBGET integrated database retrieval system