KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1645Help
Entry
SeAg_B1645        CDS       T00751                                 

Definition
(GenBank) thermolabile glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00220  Arginine biosynthesis
sea00250  Alanine, aspartate and glutamate metabolism
sea00471  D-Glutamine and D-glutamate metabolism
sea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SeAg_B1645
   00220 Arginine biosynthesis
    SeAg_B1645
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SeAg_B1645
Enzymes [BR:sea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SeAg_B1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACH50241
UniProt: B5F610
Position
complement(1611864..1612790)
Genome map
AA seq 308 aa AA seqDB search
MARAMDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRALCGVSDITYDVTVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggccagggccatggataatgcaattttagagacgattttacagcgcgttcgccccctc
attggccagggcaaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaag
ctggggatagcgatttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaa
cgcttctctattcagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattat
ccggaagaggagatctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcg
ttggttcagttagagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcg
ctggtggtatgcgacatgttgcaagggcggcttagcgcgccgcgtcagcgaatgctggaa
gttgtgcgcgcgctttgcggcgtatcggatattacgtatgacgttacggtcgcgcgctct
gaatttgagcattccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaat
tttcatcatgatgtgcctaccgtgttgcaaaattacttccactattgtgcgttgaaaatg
agttgcatggaactggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcat
ctcgacgagccggtagttacccccatgcaggcccggcagattaatgcgctaatggcgacc
agcggtatgtatcagaatgccggagagtttgcctggcgggtgggattgcccgctaaatcc
ggcgtgggcggcggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggcatcgccgcacttgagcaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system