KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1832Help
Entry
SeAg_B1832        CDS       T00751                                 

Definition
(GenBank) peroxiredoxin Hyr1 (EC:1.11.1.15)
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SeAg_B1832
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SeAg_B1832
Enzymes [BR:sea01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SeAg_B1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1794790..1795341)
Genome map
AA seq 183 aa AA seqDB search
MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVV
LGFPCNQFMGQEPGSEEEIKTYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVA
PEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQRFSPDMTPEDPIVMESIKIA
LEK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactcgcttcttaatactcacgttacgacgattgatggagaggtcactacactt
gaaaaatacgccggaaaagtgctgctcattgtaaacgtcgcctccagatgtggcctgacg
ccgcaatatgaacagttggaaaatatccagaaggcgtgggcagatcaggggtttgtcgtg
ttgggttttccctgcaaccagtttatggggcaggagccaggcagcgaagaggagattaaa
acctattgtgccagcacctggggcgtcacgttcccgatgttcagtaaaattgatgtgaat
ggcgacgcgcgccatccgctgtatcaaaaactgatagccgctgcgccaacggcagtcgcg
ccggagaagagcggcttttacgaacggatggtaagcaaagggcgtacgccactctatccg
gatgatattctgtggaattttgaaaaatttttggtaggccgggatggtcaggtggtacag
cgtttttcgccggatatgacgcctgaagatcctattgtgatggaaagcataaaaatcgcg
ttggaaaaataa

DBGET integrated database retrieval system