KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B2156Help
Entry
SeAg_B2156        CDS       T00751                                 

Gene name
cbiB
Definition
cobalamin biosynthesis protein (EC:6.3.1.10)
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SeAg_B2156 (cbiB)
Enzymes [BR:sea01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     SeAg_B2156 (cbiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2069307..2070266)
Genome map
AA seq 319 aa AA seqDB search
MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV
VVGATWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEVERPLRENDLAES
RIKLSWIVGRDTSQLQPAQINRAVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL
DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRY
NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRDISVDDISLTIRLMWVA
STLALALFIAARCGLSGVA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcttgcctggtgtatcgcctgggtgctggattttatcatcggcgaccctcaa
cactggccccatccggtacgctggataggtcgtttaatcacgtttgtgcagcgtattgtg
cgtcgctattgtcccggcgataaagcgctgcggattggcggcggcgtaatgtgggttgtg
gttgtcggggcgacctggggcgtggcatggggcgtactggcgctggcgcagcggattcac
ccctggtttggctggagcgtcgaagtctggatgatctttaccacgctggccggacgctct
ctggcccgtgccgcgcaggaggttgaacgaccgttacgggagaacgaccttgcggaaagc
cgaataaaactctcctggatcgtcgggcgcgatacgtcgcaacttcagccagcgcagatc
aatcgcgccgtggtggaaacggttgcagaaaacaccgttgacggcattatcgcgccgctc
tttttcctctttctcggcggcgcgccgctggcgatggcctacaaagccgtcaataccctg
gattcaatggtgggctacaaacatgaaaaataccgggcgattggtatggtcagcgcccgt
atggacgacgtagcgaactatcttcctgcccgactgagctggctgttgctgggcattgcg
gcaggactgtgtcgcctgagtggttggcgggcgctgcgtattggctggcgtgaccgttat
aaccacagtagcccaaattgcgcctggtcggaagcgtgtgtggccggcgccttaggtatc
cagctcggtggcccaaataactactttggcgagcgtgtggacaagccctggataggcgac
gcgcagcgcgatatttccgtggacgatatttccctaacgattcgattgatgtgggtcgct
tcaaccctggcgctggcgctgtttattgcggcgcggtgcgggttatctggcgtggcctga

DBGET integrated database retrieval system