KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B2208Help
Entry
SeAg_B2208        CDS       T00751                                 

Definition
(GenBank) putative phosphomannomutase
  KO
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SeAg_B2208
   00520 Amino sugar and nucleotide sugar metabolism
    SeAg_B2208
Enzymes [BR:sea01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     SeAg_B2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2120299..2121732)
Genome map
AA seq 477 aa AA seqDB search
MNVVNNSRDVIHSSGIVFGTSGARGLVKDFTPQVCAAFTVSFIAVMQEHFSFDTVALAID
NRPSSYGMAQACAAALADKGVNCIFYGVVPTPALAFQSMSDNMPAIMVTGSHIPFERNGL
KFYRPDGEITKHDEAAILSVEDTCSHLELKELIVSEMAAVNYISRYTSLFSTPFLKNKRI
GIYEHSSAGRDLYKPLFIALGAEVVSLGRSDNFVPIDTEAVSKEDREKARSWAKEFDLDA
IFSTDGDGDRPLIADEAGEWLRGDILGLLCSLALDAEAVAIPVSCNSIISSGCFFKHVKL
TKIGSPYVIEAFNELSRSYSRIVGFEANGGFLLGSDICINEQNLHALPTRDAVLPAIMLL
YKSRNTSISALVNELPTRYTHSDRLQGITTDKSQSLISMGRENLSNLLSYIGLENEGAIS
TDMTDGMRITLRDGCIVHLRASGNAPELRCYAEANLLNRAQDLVNTTLANIKKRCLP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagttaataatagccgtgatgttattcattcatcaggtattgtgtttggaacg
agtggggctcgcggtcttgtaaaagattttacacctcaggtatgtgctgcttttacggtt
tcatttattgccgttatgcaggaacatttttcctttgataccgtagcattggcaatagat
aatcgtccaagtagttatgggatggctcaggcgtgtgctgctgcattggcggataaaggc
gttaactgtattttttatggagtggtaccaaccccagctttggcctttcagtctatgtct
gacaatatgcctgcgataatggttacgggaagtcatattccattcgagcggaacggcctc
aagttttatcgtcctgatggtgaaatcacgaaacatgatgaggctgcgatccttagtgtt
gaagatacgtgtagccatttagaacttaaagaactcatagtttcagaaatggctgctgtt
aattatatatctcgttatacatctttattttctactccattcctgaaaaataagcgtatt
ggtatttacgaacattcaagcgctgggcgtgatctttataagcctttatttattgcattg
ggggctgaagtcgttagcttgggtagaagcgataattttgtacctatagatacagaggct
gtaagcaaagaggatcgggaaaaagctcgctcatgggctaaagagttcgatttagatgcc
atattctcgacagatggggatggtgatcgccctcttattgctgatgaggccggtgagtgg
ctaagaggcgatatactaggtctattatgttcacttgcattggatgcagaagcggtcgct
attcctgttagttgtaatagtataatctcttctggctgcttttttaaacatgttaagctt
acgaaaattggctcgccttatgttatcgaagcttttaatgaactatcgcggagttatagt
cgtattgtcggttttgaagccaatggcggctttttattaggaagcgacatctgtattaac
gagcagaatcttcatgccttaccaactcgtgatgctgtattaccagcaataatgctgctt
tacaaaagtaggaataccagcattagcgctttagtcaatgaactcccaactcgttacacc
cattctgacagattacaggggattacgactgataaaagtcaatccttaattagtatgggc
agagaaaatctgagcaacctcttaagctatattggcctggagaatgaaggtgcaatttct
acagatatgacagatggtatgcgaattaccttacgtgatggatgtattgtgcatttgcgc
gcttctggtaatgcgcctgagttacgctgctatgcagaagctaatttattaaatagagct
caggatcttgtaaatacaacgcttgctaatattaaaaaacgatgcttgccgtaa

DBGET integrated database retrieval system