KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B2208Help
Entry
SeAg_B2208        CDS       T00751                                 

Definition
phosphomannomutase
Orthology
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sea00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sea00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2120299..2121732)
Genome map
AA seq 477 aa AA seqDB search
MNVVNNSRDVIHSSGIVFGTSGARGLVKDFTPQVCAAFTVSFIAVMQEHFSFDTVALAID
NRPSSYGMAQACAAALADKGVNCIFYGVVPTPALAFQSMSDNMPAIMVTGSHIPFERNGL
KFYRPDGEITKHDEAAILSVEDTCSHLELKELIVSEMAAVNYISRYTSLFSTPFLKNKRI
GIYEHSSAGRDLYKPLFIALGAEVVSLGRSDNFVPIDTEAVSKEDREKARSWAKEFDLDA
IFSTDGDGDRPLIADEAGEWLRGDILGLLCSLALDAEAVAIPVSCNSIISSGCFFKHVKL
TKIGSPYVIEAFNELSRSYSRIVGFEANGGFLLGSDICINEQNLHALPTRDAVLPAIMLL
YKSRNTSISALVNELPTRYTHSDRLQGITTDKSQSLISMGRENLSNLLSYIGLENEGAIS
TDMTDGMRITLRDGCIVHLRASGNAPELRCYAEANLLNRAQDLVNTTLANIKKRCLP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagttaataatagccgtgatgttattcattcatcaggtattgtgtttggaacg
agtggggctcgcggtcttgtaaaagattttacacctcaggtatgtgctgcttttacggtt
tcatttattgccgttatgcaggaacatttttcctttgataccgtagcattggcaatagat
aatcgtccaagtagttatgggatggctcaggcgtgtgctgctgcattggcggataaaggc
gttaactgtattttttatggagtggtaccaaccccagctttggcctttcagtctatgtct
gacaatatgcctgcgataatggttacgggaagtcatattccattcgagcggaacggcctc
aagttttatcgtcctgatggtgaaatcacgaaacatgatgaggctgcgatccttagtgtt
gaagatacgtgtagccatttagaacttaaagaactcatagtttcagaaatggctgctgtt
aattatatatctcgttatacatctttattttctactccattcctgaaaaataagcgtatt
ggtatttacgaacattcaagcgctgggcgtgatctttataagcctttatttattgcattg
ggggctgaagtcgttagcttgggtagaagcgataattttgtacctatagatacagaggct
gtaagcaaagaggatcgggaaaaagctcgctcatgggctaaagagttcgatttagatgcc
atattctcgacagatggggatggtgatcgccctcttattgctgatgaggccggtgagtgg
ctaagaggcgatatactaggtctattatgttcacttgcattggatgcagaagcggtcgct
attcctgttagttgtaatagtataatctcttctggctgcttttttaaacatgttaagctt
acgaaaattggctcgccttatgttatcgaagcttttaatgaactatcgcggagttatagt
cgtattgtcggttttgaagccaatggcggctttttattaggaagcgacatctgtattaac
gagcagaatcttcatgccttaccaactcgtgatgctgtattaccagcaataatgctgctt
tacaaaagtaggaataccagcattagcgctttagtcaatgaactcccaactcgttacacc
cattctgacagattacaggggattacgactgataaaagtcaatccttaattagtatgggc
agagaaaatctgagcaacctcttaagctatattggcctggagaatgaaggtgcaatttct
acagatatgacagatggtatgcgaattaccttacgtgatggatgtattgtgcatttgcgc
gcttctggtaatgcgcctgagttacgctgctatgcagaagctaatttattaaatagagct
caggatcttgtaaatacaacgcttgctaatattaaaaaacgatgcttgccgtaa

DBGET integrated database retrieval system