KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B2223Help
Entry
SeAg_B2223        CDS       T00751                                 

Gene name
galF
Definition
(GenBank) regulatory protein GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00040  Pentose and glucuronate interconversions
sea00052  Galactose metabolism
sea00500  Starch and sucrose metabolism
sea00520  Amino sugar and nucleotide sugar metabolism
sea01100  Metabolic pathways
sea01130  Biosynthesis of antibiotics
Module
sea_M00362  Nucleotide sugar biosynthesis, prokaryotes
sea_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SeAg_B2223 (galF)
   00052 Galactose metabolism
    SeAg_B2223 (galF)
   00500 Starch and sucrose metabolism
    SeAg_B2223 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SeAg_B2223 (galF)
Enzymes [BR:sea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SeAg_B2223 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ACH48717
UniProt: B5EXS5
Position
complement(2136823..2137716)
Genome map
AA seq 297 aa AA seqDB search
MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaaaccgatgattcagtacatt
gtcgatgagattgtggctgcagggatcaaagaaatcgtactggtgactcacgcgtctaaa
aacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttcttgaacagcgc
gttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtgacgattatg
aacgttcgccaggcacagccgttagggctggggcactctattctgtgcgcgcgtccggtc
gtgggcgataaccctttcattgtggtactcccggatattattattgatgatgctaccgcc
gatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacgggtcgcagc
caggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatccagacgaaa
gaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaaaaaccggat
cagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctttcagccgac
atctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccagctcaccgat
gccattgctgagctggcgaaaaaacagtcggttgacgcgatgctaatgacgggtgacagc
tatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacgggctgcgcaac
ctgaaagaaggagccaagttccgtaagagcatagagcagcttttgcatgaataa

DBGET integrated database retrieval system