KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B2546Help
Entry
SeAg_B2546        CDS       T00751                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00010  Glycolysis / Gluconeogenesis
sea00052  Galactose metabolism
sea00500  Starch and sucrose metabolism
sea00520  Amino sugar and nucleotide sugar metabolism
sea00521  Streptomycin biosynthesis
sea01100  Metabolic pathways
sea01110  Biosynthesis of secondary metabolites
sea01120  Microbial metabolism in diverse environments
sea01130  Biosynthesis of antibiotics
sea01200  Carbon metabolism
Module
sea_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sea_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeAg_B2546 (glk)
   00052 Galactose metabolism
    SeAg_B2546 (glk)
   00500 Starch and sucrose metabolism
    SeAg_B2546 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SeAg_B2546 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SeAg_B2546 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SeAg_B2546 (glk)
Enzymes [BR:sea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SeAg_B2546 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACH51955
UniProt: B5F0D6
Position
complement(2479216..2480181)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgtccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtccggcttccgtggtggc
tttgaagataaaggccgctttaaagattatgtacacggaattccggtctatctgattgtc
catgataatcctggcttgttaggctccggcgcgcatctgcgccagacattaggccatatt
ctataa

DBGET integrated database retrieval system