KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B2861Help
Entry
SeAg_B2861        CDS       T00751                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Brite
Enzymes [BR:sea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SeAg_B2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2802199..2802708)
Genome map
AA seq 169 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQSLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVVPGKTITERQAAQGLITNVLRVERALDKCVVQPMPQKVYDAVVSFAFNVGTGNAC
SSTLVKLLNQRRWADACHQLPRWVYVKGVFNQGLDNRRAREMAWCLKGA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttcaatcgttaagcgctgccttgtcggggcggtgctggctatcgcagccacg
ctgcccggatttcagtcgcttcatacctccgttgaggggctgaaactgatcgccgattac
gagggatgccgcctgcagccttatcagtgcagcgcgggcgtctggactgacgggatcggc
aatacgtccggtgtggtgcctggaaaaaccatcacggaacggcaggcggcgcagggactt
atcaccaacgtgctgcgcgtggagcgagcactggataaatgtgtggtgcagccgatgccg
caaaaggtctatgacgcagtggtgtcgtttgctttcaacgtgggcaccggcaacgcctgc
agctccacgctggttaagttgctgaaccagcggcgctgggcggatgcctgccatcagctg
ccgcgctgggtatatgtcaaaggtgtgtttaatcaggggctggacaaccgccgcgcgcgg
gaaatggcctggtgcttaaaaggagcataa

DBGET integrated database retrieval system