KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B3139Help
Entry
SeAg_B3139        CDS       T00751                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sea03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3061705..3063540)
Genome map
AA seq 611 aa AA seqDB search
MTIQERLLEAVEQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETATPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRTE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccaggagcggttgctggaggccgttgaacaaaaactcttacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacggctacgccaatcgac
tggaaaaagcggttactggcgtctgcggcggttagctgcggcgatagccccgcgccgtta
attctgtgcggcgatcgcctctacctgaatcgcatgtggtgcaacgagcgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcagcgccgaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttcctcttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctgggcgcacagcccggcagtcagcgattacgccatcatgcgggcaacccg
ctgcatctggacgtgctggtggtcgatgaggcatcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactaacagggagcgccattccggcgggg
gccggaacgcaagccgcgtctttacgcgatagcctctgtttgttgcaaaagagctaccgt
ttcggcagcgattctggcatcggcaagctggcggcggcgattaactgcggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagc
agcgacgattatgccgggatgctggatgaagcgctggcgggctatgggcgctacctgcgg
ttgctgcatgagaaagcgacgccggaggcaatcctgcaggctttcaatgagtatcaactg
ctttgcgcgctgcgtgaaggcccatttggcgtgaggggactgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcatccgcactctcgctggtatgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgttggggctatttaacggcgatattggtatt
gcgctcgatcgcggacaggggttacgcgtctggtttgtgatgccggacggcaccatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacaggggtctgaatttgatcacgccgcgctgattttacccagccaacgttcgccggtc
gtgacgcgggagctggtgtataccgcggttacgcgggcgcggcggcgattatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgaacggaacggcgcagcgggtta
gccaccttatttgatgaagtcagtcgtaccgaataa

DBGET integrated database retrieval system