KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4112Help
Entry
SeAg_B4112        CDS       T00751                                 

Gene name
rbsK
Definition
(GenBank) ribokinase (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SeAg_B4112 (rbsK)
Enzymes [BR:sea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SeAg_B4112 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4013297..4014226
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLIVLGSINADHILNLESFPTPGETVTGSHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDIGDSIRKQLVSDRIDIAPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVDAQRERIAQADALLMQLESPLESVLAAAKIAHQHHTTVALNPAPARELPDELLAL
VDIITPNETEAEKLTGVRVENDDDAAKAAQVLHDKGIRTVLITLGSRGVWASVNGEGRRV
PGFSVEAVDTIAAGDTFNGAFITAILEETPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IEAFLHQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggtaatctcatcgtccttggcagcattaatgccgatcatatccttaat
cttgagtccttccctaccccgggtgaaacggtaaccggtagccattatcaggtcgcgttt
ggcgggaaaggcgcgaatcaggcggttgctgcgggacgtagcggggcaaatattgcgttt
atagcctgcacgggcgatgacgatattggcgacagtattcgtaaacaattagtcagcgat
cgtattgatatcgcgccagttagcgttattaaaggcgagtctaccggggtggcgctgatt
ttcgttaacggcgaaggcgagaacgtcatcggtattcatgccggagcgaatgccgcgtta
tcgccggcgttggttgatgcgcaacgtgaacgtatcgcgcaggcggatgcgttactgatg
cagctggaatcgccgctggaaagcgtactggcggcggcgaaaatcgcccatcaacatcat
actactgttgcgctgaacccggcgcctgcccgtgagctaccggatgaactgctggcgctg
gtggacatcatcacgccaaatgaaacggaagctgaaaagctgacgggcgtgcgtgtggaa
aatgacgacgatgccgcgaaagctgcgcaggttttgcatgataaaggcattcgaaccgta
ttaattaccttaggaagccgtggcgtctgggccagcgtaaacggcgagggccgccgcgtt
cctggatttagcgttgaggctgtcgataccattgccgccggagatacgtttaacggcgcc
tttatcaccgcgatactggaggagacgccgttgccggaagcgattcgctttgcccatgcc
gccgccgcgattgccgtaacgcgtaaaggcgcgcaaccttccgttccgtggcgcgaagag
atagaagcgtttttacatcagcaggggtaa

DBGET integrated database retrieval system