KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4165Help
Entry
SeAg_B4165        CDS       T00751                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00860  Porphyrin and chlorophyll metabolism
sea01100  Metabolic pathways
sea01110  Biosynthesis of secondary metabolites
sea01120  Microbial metabolism in diverse environments
Module
sea_M00121  Heme biosynthesis, glutamate => heme
sea_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SeAg_B4165 (hemD)
Enzymes [BR:sea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SeAg_B4165 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACH49246
UniProt: B5EZ59
Position
complement(4064058..4064798)
Genome map
AA seq 246 aa AA seqDB search
MSILITRPSPAGEALVSRLRALGQVAWSFPLIEFVAGRELPTLADRLATLTENDLVFALS
QHAVAFAHAQLQRDGRNWPASPRYFAIGRTTALALHTVSGFDIRYPLDREISEALLQLPE
LQNIAGKRALILRGNGGRELLGETLTARGAEVSFCECYQRCAKHYDGAEEAMRWHTRGVT
TLVVTSGEMLQRLWSLTPQWYREHWLLRCRLLVVSERLAHLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctgatcacccgcccctctcccgcaggggaagcattagtgagccgtctgcgc
gcactggggcaggtggcctggagttttccactgattgaatttgtcgccggccgggagcta
cccaccctggccgaccgcctggcgacgctgacggaaaacgatctggtttttgccctttca
cagcacgccgtcgcctttgctcacgcccagctccagcgggatggccgaaactggcctgcg
tcgccgcgctatttcgcgattggccgcaccacggcgctcgcccttcataccgttagcggg
ttcgatattcgttatccattggatcgggaaatcagcgaagccttgctacaattacctgaa
ttacaaaatattgcgggcaaacgcgcgctaattttgcgtggcaatggcggccgcgaactg
ctgggcgaaaccctgacagctcgcggagccgaagtcagtttttgtgaatgttatcaacga
tgtgcgaaacattacgatggcgcggaagaagcgatgcgctggcatactcgcggcgtaaca
acgcttgttgttaccagcggcgagatgttgcaacggctctggtcgctgactccccagtgg
tatcgtgagcactggttactacgctgtcggctattggtcgtcagtgagcgtctggcgcac
ctcgcccgggaactgggctggcaagatattaaggtcgctgataacgccgacaacgatgcg
ctgttgcgcgcattacaataa

DBGET integrated database retrieval system