KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4190Help
Entry
SeAg_B4190        CDS       T00751                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SeAg_B4190 (pldB)
Enzymes [BR:sea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SeAg_B4190 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4085609..4086625
Genome map
AA seq 338 aa AA seqDB search
MFQQQNDWETRENAFAAFAMGPLTDFWRQREEAEFIGVGNIPVRFVRFRNDSNDRTIVIC
PGRIESYVKYAELAYDLFHLGFDIFIIDHRGQGRSGRMLSDPHRGHVDHFNDYVEDLAAF
WQQEIEPGPWRKRYILAHSMGGAIATLFLQRHRVRCDAIALTAPMFGIVIRLPSFMVRHI
LDWAEGHQRIREDYAIGTGQWRALPFGMNALTHSRQRYQRNLRFYADEPQLRVGGPTWHW
VREGILAGEQVLAGASDDTTPTLLIQAEEERVVDNRTHDRFCEIRAAAGYPCEGGKPLVI
KGAYHEILFEKDAMRSVALNAIVEFFNKPNLSSGNRFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaatgactgggaaacaagagaaaatgcgtttgccgcttttgctatg
gggccgctgaccgatttctggcgtcagcgggaagaggcagagtttatcggcgtgggtaac
attccggtgcgctttgtccgttttcgaaatgattccaacgatcggacgatcgtcatttgt
cctggccgcattgagagttatgtaaaatacgctgaactggcgtatgacctttttcatctc
ggttttgatatcttcatcatcgaccaccgtggtcaagggcgctccgggcggatgttatcg
gacccgcatcggggtcatgttgatcattttaacgattatgttgaggacttagcggcgttc
tggcagcaggaaattgagccggggccgtggcgtaagcgttatatcctggcgcactcaatg
gggggcgcgatagccaccctgttcctgcaacgccatcgtgtgcggtgcgacgctattgcg
ctcaccgcgccgatgtttggtattgtgatacgcttgccttcctttatggtgcgccatatt
ctcgactgggccgaggggcaccagcgtatccgtgaagattacgctattggtaccggtcag
tggcgggcgttgccgtttgggatgaatgcgctgacccacagccgccagcgttatcagcgc
aacttacgattttatgccgacgagccgcagctgcgcgttggcggccccacctggcattgg
gtacgcgaaggcattctggcgggtgagcaggttctggctggggcgagcgatgacacgacg
cctacgctactgattcaggcggaagaagagcgggtagtggataaccgcacccacgatcgt
ttttgtgaaattcgcgccgcggcgggatacccttgtgaagggggaaaaccgctggttatc
aaaggcgcgtaccatgagatcctttttgaaaaggacgccatgcgctcagtcgcgcttaac
gccattgttgaatttttcaacaagcctaatttatccagcggaaatcgctttgcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system