KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4683Help
Entry
SeAg_B4683        CDS       T00751                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SeAg_B4683 (cysQ)
Enzymes [BR:sea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SeAg_B4683 (cysQ)
Transfer RNA biogenesis [BR:sea03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SeAg_B4683 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4574103..4574843
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGAKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVL
KVMYYAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPG
FRVTIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgccagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggagccaaaccgatggagtacgcccgcaagcaggacgattctccagtcactgcggcg
gatatcgccgcacataccgtgattctcgaagggttacgcacgctcacgccggatattccg
gtgctttcagaagaagatccgcctgcctgggaagtgcgccagcactggcagcgctactgg
ctggtcgatccgctcgacggcaccaaagagttcatcaagcgcaatggcgaattcacggtc
aatatcgcgctgattgagcagggcaaaccggtgttgggcgtggtctatgcgccggtgctg
aaagtgatgtactacgcggcggaaggtaaggcctggaaagaggagtgcggggtgcgtaag
cagattcaggtccgggatgcccgcccgccgctggtggtgattagccgttcgcatacggat
gatgaactcaccgaatatctccaacagcttggcgaacatcagaccacctctattggttcc
tcgctgaaattctgccttgtggcggaaggccaggcgcagctttaccccagatttgggccg
accagcgtctgggacactgccgcaggtcatgccattgctgttgcagccggggcgcacgtt
cacgactggcagggaaaaacgctggactatacccctcgtgaatcgttccttaaccccggc
ttccgggtgactatttactga

DBGET integrated database retrieval system