KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4708Help
Entry
SeAg_B4708        CDS       T00751                                 

Definition
O-Glycosyl hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SeAg_B4708
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SeAg_B4708
Enzymes [BR:sea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SeAg_B4708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4601347..4602690
Genome map
AA seq 447 aa AA seqDB search
MKGRLISSDPYRQQFLVERAVSFSHRQRDCSELISVLPRHTLQQIDGFGGSFTEGAGVVF
NSMSEKTKAQFLSLYFSAQEHNYTLARMPIQSCDFSLGNYAYVDSSADLQQGRLSFSRDE
AHLIPLISGALRLNPHMKLMASPWSPPAFMKTNNDMNGGGKLRRECYADWADIIINYLLE
YRRHGINVQALSVQNEPVAVKTWDSCLYSVEEETAFAVQYLRPRLARQGMDEMEIYIWDH
DKDGLVDWAELAFADEANYKGINGLAFHWYTGDHFSQIQYLAQCLPDKKLLFSEGCVPME
SDAGSQIRHWHTYLHDMIGNFKSGCSGFIDWNLLLNSEGGPNHQGNLCEAPIQYDAQNDV
LRRNHSWYGIGHFCRYVRPGARVMLSSSYDNLLEEVGFVNPDGERVLVVYNRDVQERRCR
VLDGDKEIALTLPPSGASTLLWRQESI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcagactcatctcttccgatccgtatcgtcagcaattccttgttgagcgtgcg
gtctctttttcgcatcgtcagcgtgattgcagtgaattaatcagcgtcttaccgcgccac
acgttacagcagattgacggattcggcggcagctttaccgaaggtgcgggcgtggtattc
aacagcatgagcgaaaagacgaaggcgcaatttctttccctttatttttctgctcaggaa
cataattacactctggcgcggatgccaattcagagctgtgatttttccctgggcaattac
gcgtatgtcgattccagcgctgacctgcagcagggacggctctccttttcccgcgatgaa
gcgcatttaataccgctgatttccggggcgttgcggttaaatccacatatgaagctgatg
gcttcgccgtggagtccgccggcgtttatgaaaactaataacgatatgaacggtggcggc
aagctgcggcgcgaatgctacgccgactgggccgatatcattatcaactacctgctggaa
taccgccgccacggcattaatgtgcaggcgctctccgtgcagaatgagccggtggcggta
aaaacctgggactcctgtctgtatagcgtggaagaggagacagcctttgccgtgcagtat
ctgcgtccgcgcctcgcccggcagggtatggatgagatggagatctatatctgggatcac
gataaagatggcctggtggactgggctgaactcgcctttgctgacgaagctaattataag
ggaattaacgggctggcattccactggtataccggcgaccatttttcgcaaatacagtat
ctggcccagtgcctgccggataaaaaactcctgttttccgaaggctgtgtgccaatggag
agcgatgccggtagccagattcgccactggcatacctatctccatgacatgattggtaat
ttcaaatcgggttgtagcgggtttatcgactggaatctgctgttgaacagtgaggggggg
ccgaatcatcagggtaatctgtgtgaagcgcccattcaatacgatgcgcaaaacgacgtg
ctgcggcgtaaccactcctggtatggtattggccacttctgccgctatgtgcgtccgggg
gcgagggtcatgctttcttcaagttacgataatcttctggaagaggtgggatttgtgaat
cccgacggcgagcgtgtgctggtggtgtataaccgcgatgtccaggaaaggcgttgtcgg
gtgctggatggcgataaagagatcgcgttaacgctgccgccgtcaggcgccagtacgttg
ctatggcggcaggagtcgatctga

DBGET integrated database retrieval system