KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_0189Help
Entry
STM474_0189       CDS       T01760                                 

Gene name
panD
Definition
aspartate alpha-decarboxylase
Orthology
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:seb00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:seb00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(211027..211407)
Genome map
AA seq 126 aa AA seqDB search
MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAI
AAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEMKRTAKA
IPVQVA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcaccatgctgcaaggcaagctccaccgcgtaaaagtcacgcaggcggacctg
cactacgaaggttcctgtgccattgaccaggatttccttgatgcctccggtattctggaa
aacgaagcgattgatatctggaacgtgaccaatgggaaacgtttctcaacctatgcgatt
gcggctgaacgcggctccagaatcatctcggtgaacggtgcggcggcgcactgcgctgaa
gttggcgacattgtgattatcgccagcttcgtcaccatgtctgatgaagaagcgcgtaca
tggcgtccgaaagtggcctattttgaaggcgacaacgaaatgaagcgcaccgcgaaagct
attccggtacaggttgcctga

DBGET integrated database retrieval system