KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_0527Help
Entry
STM474_0527       CDS       T01760                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    STM474_0527 (tesA)
Enzymes [BR:seb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     STM474_0527 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     STM474_0527 (tesA)
Lipid biosynthesis proteins [BR:seb01004]
 Fatty acid synthase
  Component type
   STM474_0527 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(565342..565956)
Genome map
AA seq 204 aa AA seqDB search
MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAASAAWPSLLNDKWQNKT
SVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGFAPAQTEQTLRKIIQTV
KAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLTPFLS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacactgttttccgctggcatttgcccttcctgtttttgatcctgttaact
ttccgtgccgccgccgcagacaccttattaattctgggcgatagcctcagcgccggttac
cgtatggccgccagcgcggcatggccgtcgctccttaatgataaatggcaaaacaaaacg
tcggtcgttaatgccagtataagcggagatacctcgcagcagggactggcgcgtttgccg
gcgctgttgcaacagcatcacccgcgctgggtagtggtggaacttggcggcaacgatggc
ctacgcggttttgcgcctgcgcaaaccgaacagacgctacgtaaaatcattcagacggtg
aaagccgccgatgcccaaccgttactgatgcaaattcatctgcccgctaactacggtcgc
cgttataatgaatcctttagcgccatttatcctaagctcgccaaagagttcgatattcct
ctgttaccgttttttatggaagaggtatatctgaaaccgcagtggatgcaggatgacggc
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgacc
ccttttctctcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system