KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_0527Help
Entry
STM474_0527       CDS       T01760                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:seb01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(565342..565956)
Genome map
AA seq 204 aa AA seqDB search
MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAASAAWPSLLNDKWQNKT
SVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGFAPAQTEQTLRKIIQTV
KAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLTPFLS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacactgttttccgctggcatttgcccttcctgtttttgatcctgttaact
ttccgtgccgccgccgcagacaccttattaattctgggcgatagcctcagcgccggttac
cgtatggccgccagcgcggcatggccgtcgctccttaatgataaatggcaaaacaaaacg
tcggtcgttaatgccagtataagcggagatacctcgcagcagggactggcgcgtttgccg
gcgctgttgcaacagcatcacccgcgctgggtagtggtggaacttggcggcaacgatggc
ctacgcggttttgcgcctgcgcaaaccgaacagacgctacgtaaaatcattcagacggtg
aaagccgccgatgcccaaccgttactgatgcaaattcatctgcccgctaactacggtcgc
cgttataatgaatcctttagcgccatttatcctaagctcgccaaagagttcgatattcct
ctgttaccgttttttatggaagaggtatatctgaaaccgcagtggatgcaggatgacggc
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgacc
ccttttctctcctga

DBGET integrated database retrieval system