KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_0797Help
Entry
STM474_0797       CDS       T01760                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00010  Glycolysis / Gluconeogenesis
seb00260  Glycine, serine and threonine metabolism
seb00680  Methane metabolism
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01120  Microbial metabolism in diverse environments
seb01130  Biosynthesis of antibiotics
seb01200  Carbon metabolism
seb01230  Biosynthesis of amino acids
Module
seb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seb_M00002  Glycolysis, core module involving three-carbon compounds
seb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM474_0797 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    STM474_0797 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STM474_0797 (gpmA)
Enzymes [BR:seb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STM474_0797 (gpmA)
Membrane trafficking [BR:seb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    STM474_0797 (gpmA)
Exosome [BR:seb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STM474_0797 (gpmA)
  Exosomal proteins of melanoma cells
   STM474_0797 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADX16509
UniProt: E8XB02
Position
complement(835617..836369)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system