KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_1206Help
Entry
STM474_1206       CDS       T01760                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STM474_1206 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    STM474_1206 (nagZ)
Enzymes [BR:seb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     STM474_1206 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1248749..1249774
Genome map
AA seq 341 aa AA seqDB search
MGPVMLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETP
CDPRPETDIRGKDMSVFRTLISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagata
ctggcgcatccgctggttggcgggcttattctgttcacgcgtaattaccatgacccggaa
cagttgcgcgaattagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggcc
gtcgatcaggaaggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcg
gcgcaatctttttttgcgctgcatgggctggaagagggggggcgactggcgcaggaggca
gggtggctgatggccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtg
ctggatgtcgggcatatcagcgcggcaattggcgagcgttcttatcatgccgatccagca
aaagcgttggcaatggcaacgcgctttattgacggcatgcatgacgccgggatgaaaacg
accggtaagcatttccccggccacggcgcggtcacggcggactcccacaaagagacgccg
tgcgatccacgtcctgaaacggacatccgtggcaaagatatgtcggtgttccgcacgctg
attagcgagaataaactggatgcgattatgcctgcccacgtgatctaccgcgctatcgat
ccgcgtccggcaagcggttcgccgtactggctgaaaacggtgctgcgtcaggagttaggc
tttgatggcgtcattttctccgacgatctgtcgatggagggcgcggcgattatgggcagc
tatgctgagcgcgctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaat
aatcgtaaaggcgcagtcagcgtgctggataatctgtcgccgatcaaagcagaacgtgtt
acacgtttgtatcataaaggttcattttcacgccgggagctcatggactcagcacgctgg
aaaacagccagcgcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggt
cattaa

DBGET integrated database retrieval system