KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_1767Help
Entry
STM474_1767       CDS       T01760                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STM474_1767 (tdk)
Enzymes [BR:seb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     STM474_1767 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1802856..1803524)
Genome map
AA seq 222 aa AA seqDB search
MVQSRQSLFHSGEVLRPMAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDR
FGAGKVSSRIGLSSPAKLFNQNTSLFEEIRAESARQTIHCVLVDESQFLTRQQVYQLSEV
VDKLDIPVLCYGLRTDFRGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQDGRP
YNEGEQVVIGGNERYVSVCRKHYKDALEEGSLTAIQERHRHI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtacaatcccgccaatctttatttcactcaggtgaggtcctgcgaccaatggcacag
ctatatttctactattcggcaatgaatgcgggtaagtcgactgcactgctgcaatcttca
tacaattatcaggaacgcgggatgcgtaccgtcgtatatacggcggaaatcgacgatcgt
ttcggcgcaggcaaagtcagctctcgtatcggtttgtcgtcgccggcaaaattgtttaac
caaaatacatccttgtttgaagagattcgtgccgagagcgcgcggcagacaatacattgc
gtgttagtcgacgaaagccagtttttgactcgccagcaggtttatcaattatccgaggtt
gtcgacaaattagatattccagtactttgctatgggctacgaacagactttcgtggggag
ctctttgtcggcagccaatacttgctggcatggtcagataagctggtggaattaaaaact
atctgtttctgcggtcgtaaagccagtatggttctgcgccttgatcaggacggcaggcct
tataacgaaggcgaacaggtggttattggcgggaatgaacgctacgtttcagtttgccgt
aagcattataaggacgcgctggaggagggctcactgacggcgattcaggagcgtcatcgg
cacatatga

DBGET integrated database retrieval system