KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_3139Help
Entry
STM474_3139       CDS       T01760                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:seb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STM474_3139 (recD)
Enzymes [BR:seb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     STM474_3139 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3165738..3167573)
Genome map
AA seq 611 aa AA seqDB search
MTIQERLLEAVEQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVACISETATPIDWKKRLLASAAVSCGDSPAPLILCGERLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDSLPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRTG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccaggagcggttgctggaggccgttgaacaaaaactcttacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctgtataagcgaaacggctacgccaatcgac
tggaaaaagcggttactggcgtctgcggcggttagctgcggcgatagccccgcgccgtta
attctgtgcggcgagcgtctctacctgaatcgcatgtggtgcaacgaacgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcagcgccgaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttcctcttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctaggcgcacagcccggcagccaacgattacgccatcatgcgggcaacccg
ctacatctggacgtgctggtggtcgatgaagcatcaatgattgatttgccgatgatgtca
cgtttgattgactctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactcactggtagcgccattccggcgggg
gccggaacgcaagccgcatctttacgcgatagcctctgtttgttgcaaaagagctatcgt
ttcggcagcgattctggcatcggcaagctggcggcggcaattaactgcggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagc
agcgacgattatgccgggatgctggatgaagcgctggcgggctatggtcgctacctgcgg
ttgctgcatgaaaaagcgacgccggaggcaatccttcaggctttcaatgagtatcaactg
ctttgtgcgctgcgcgaaggcccatttggcgtgaggggattgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcacccgcattctcgctggtacgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgttggggctatttaacggcgatattggtatt
gcgctcgatcgcgggcaggggttacgcgtctggtttgtgatgccggacggcacgatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacaggggtctgaatttgatcacgccgcgctgattttacccagccagcgttcgccggtc
gtgacgcgggagctggtgtataccgctgttacgcgagcgcggcggcggttatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgtacggagcggcgcagcgggcta
gccaccttatttgatgaagtcagtcgtaccggataa

DBGET integrated database retrieval system