KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_3899Help
Entry
STM474_3899       CDS       T01760                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:seb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3942446..3943255)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWPVSDEIYRLSDTPVLSVQRRAKYLL
LELPDGWIIIHLGMSGSLRILPEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKEL
EGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRHCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccggggtattgaaccccatttagttggc
gctactatcctgcacgcccatatccgtaacggccgtctgcgctggccggtttcagatgaa
atttatcgtctgagcgatacacccgtccttagcgttcagcgtcgtgctaaatatctactg
ctggagctgcctgacggctggataattattcacctggggatgtcgggaagcttgcggata
ctgccggaagcgctgccggcggaaaagcacgaccatgtcgatttggtgatgagcaacggc
aaaattctacgttataccgatcctcgccgctttggcgcctggttatggaccaaagagctg
gaagggcataacgtactggcgcatctgggaccggagccgctaagcgatgagtttaatggc
gaatatttgcagcagaaatgcgcgaagaagaagacggcgattaaaccctggctgatggat
aacaagctggtggtcggcgtggggaatatctacgccagcgagtcgctgtttgccgctggt
attcaccctgaccgcctggcgtcgtcactctcgacagaggagtgcgacctgctggcgcgg
gtgattaaagccgttttgctgcgctctattgaacaaggcgggacaacgctgaaggatttt
ctgcaaagcgatgggaagccgggctattttgcccaggagttgcaggtgtacgggcgcaaa
ggcgagccgtgtcgggtatgcggtacgccgatagtcgcaacgaaacacgcacagcgcgcg
acgttctattgccgtcactgtcagaagtaa

DBGET integrated database retrieval system