KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_4087Help
Entry
STM474_4087       CDS       T01760                                 

Gene name
ilvC
Definition
ketol-acid reductoisomerase
Orthology
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    STM474_4087 (ilvC)
   01230 Biosynthesis of amino acids
    STM474_4087 (ilvC)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    STM474_4087 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    STM474_4087 (ilvC)
Enzymes [BR:seb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase
     STM474_4087 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4138923..4140398
Genome map
AA seq 491 aa AA seqDB search
MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDSG
LDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDKQHSDVVRSVQP
LMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPQGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVL
MIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFSYACVPLLKPFMAELQPGDLGSAIPEGAVDNAQLRDVNDAIRSHAIEQVGKKLRGY
MTDMKRIAVAG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggctaactactttaatacactgaatctgcgccagcagctggcgcagttgggtaaatgc
cgctttatgggccgcgacgaattcgccgacggcgcgagctaccttcagggtaaaaaagtg
gtcatcgtcggctgtggcgctcagggtctgaaccagggcctgaacatgcgtgactccggt
ctggatatttcctacgccctgcgtaaagaagccattgctgagaagcgtgcttcctggcgt
aaagcgaccgagaacggcttcaaagtaggcacctacgaagagctgatcccgcaggctgac
ctggtagttaacctgacgccggacaaacagcactccgacgtggtgcgttccgtacagccg
ctgatgaaagacggcgcggcgctgggctactcccacggcttcaacatcgtggaagtgggc
gagcagatccgtaaagacatcaccgtggtgatggtggcgccgaagtgtccgggcaccgaa
gtacgtgaagaatacaagcgtggcttcggtgtgccgacgctgatcgccgttcacccggaa
aacgatccgcaaggcgaaggcatggcgattgctaaagcctgggcggcggcgaccggcggt
caccgtgcgggcgtactggagtcttctttcgtggcggaagtgaaatccgacctgatgggc
gagcagaccatcctgtgcggtatgctgcaggccggttctctgctgtgtttcgacaagctg
gtggcagaaggcaccgacccggcttatgcggaaaaactgattcagttcggctgggaaacc
atcaccgaagcgctgaagcagggcggcatcaccctgatgatggaccgtctgtctaacccg
gcgaaactgcgtgcttacgcgctgtccgaacagctgaaagagatcatggcgccgctgttc
cagaaacacatggatgacatcatctccggcgaattctcttccggcatgatggctgactgg
gctaacgacgataagaaactgctgacctggcgtgaagagaccggcaaaaccgcgttcgaa
accgcgccgcagtatgaaggcaaaatcggcgagcaggagtactttgataaaggcgtgctg
atgatcgcgatggtgaaagcgggcgttgagttggcgttcgaaactatggtggattccggc
atcatcgaagaatccgcttactacgaatcactgcacgagctgccgctgatcgccaacacc
atcgcccgtaagcgtctgtacgaaatgaacgtggttatctctgataccgcagaatacggt
aactacctgttctcttacgcttgcgtaccgctgctgaaaccgtttatggcggaattgcaa
ccgggcgatctgggtagtgctatcccggaaggcgcggtagacaacgcacagcttcgcgac
gtgaacgacgcgattcgtagtcatgcgattgagcaggtaggtaagaaactgcgcggctat
atgacggatatgaagcgtattgcggtagcgggttga

DBGET integrated database retrieval system