KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_4139Help
Entry
STM474_4139       CDS       T01760                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    STM474_4139 (pldB)
Enzymes [BR:seb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     STM474_4139 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4187310..4188422
Genome map
AA seq 370 aa AA seqDB search
MSVFVPQYATAAVLCQARRKKRFYLVNEAENPMFQQQNDWETRENAFAAFAMGPLTDFWR
QREEAEFIGVGNIPVRFVRFRNDSNDRTIVICPGRIESYVKYAELAYDLFHLGFDIFIID
HRGQGRSGRMLSDPHRGHVDHFNDYVEDLAAFWQQEIEPGPWRKRYILAHSMGGAIATLF
LQRHRVRCDAIALTAPMFGIVIRLPSFMVRHILDWAEGHQRIREDYAIGTGQWRALPFGM
NALTHSRQRYQRNLRFYADEPQLRVGGPTWHWVREGILAGEQVLAGASDDTTPTLLIQAE
EERVVDNRTHDRFCEIRAAAGYPCEGGKPLVIKGAYHEILFEKDAMRSVALNAIVEFFNK
PNLSSGNRFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgtttttgtgccacaatacgctactgccgctgtgttgtgtcaggcacgacgcaaa
aaacgattttacctggtaaacgaggccgaaaacccgatgtttcagcagcaaaatgactgg
gaaacaagagaaaatgcgtttgccgcttttgctatggggccgctgaccgatttctggcgt
cagcgggaagaggcggagtttatcggcgtgggtaacattccggtgcgctttgtccgtttt
cgaaatgattccaacgatcggacgatcgtcatttgtcctggccgcattgagagttatgta
aaatacgctgaactggcgtatgacctttttcatctcggttttgatatcttcatcatcgac
caccgtggtcaagggcgctccgggcggatgttatcggacccgcatcggggtcatgtcgat
cattttaacgattatgttgaggacttagcggcgttctggcagcaggaaattgagccgggg
ccgtggcgtaagcgttatatcttggcgcactcaatggggggcgcgatagccaccctgttc
ctgcaacgccatcgtgtgcggtgcgacgctattgcgctcaccgcgccgatgtttggtatt
gtgatacgcttgccttcctttatggtgcgccatattctcgactgggccgaagggcaccag
cgtatccgtgaagattacgctattggtaccggtcagtggcgggcgttgccgtttgggatg
aatgcgctgacccacagccgccagcgttatcagcgcaacttacgattttatgccgacgag
ccgcagctgcgcgttggcggccccacctggcattgggtacgcgaaggcattctggcgggt
gagcaggtactggctggggcgagcgatgacacgacgcctacgctactgattcaggcggaa
gaagagcgggtagtggataaccgcacccacgatcgtttttgtgaaattcgcgccgcggcg
ggatacccttgtgaagggggaaaaccgctggttatcaaaggcgcgtaccatgagatcctt
tttgaaaaggacgccatgcgctcagtcgcgcttaacgccattgttgaatttttcaacaag
cctaatttatccagcggaaatcgctttgcttag

DBGET integrated database retrieval system