KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_4161Help
Entry
STM474_4161       CDS       T01760                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00071  Fatty acid degradation
seb00280  Valine, leucine and isoleucine degradation
seb00281  Geraniol degradation
seb00310  Lysine degradation
seb00362  Benzoate degradation
seb00380  Tryptophan metabolism
seb00410  beta-Alanine metabolism
seb00640  Propanoate metabolism
seb00650  Butanoate metabolism
seb00903  Limonene and pinene degradation
seb00930  Caprolactam degradation
seb01040  Biosynthesis of unsaturated fatty acids
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01120  Microbial metabolism in diverse environments
seb01130  Biosynthesis of antibiotics
seb01200  Carbon metabolism
seb01212  Fatty acid metabolism
Module
seb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STM474_4161 (fadB)
   00650 Butanoate metabolism
    STM474_4161 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    STM474_4161 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    STM474_4161 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STM474_4161 (fadB)
   00310 Lysine degradation
    STM474_4161 (fadB)
   00380 Tryptophan metabolism
    STM474_4161 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STM474_4161 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STM474_4161 (fadB)
   00281 Geraniol degradation
    STM474_4161 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STM474_4161 (fadB)
   00930 Caprolactam degradation
    STM474_4161 (fadB)
Enzymes [BR:seb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STM474_4161 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STM474_4161 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STM474_4161 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     STM474_4161 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADX19760
UniProt: E8XJH1
Position
complement(4210856..4213171)
Genome map
AA seq 771 aa AA seqDB search
MISAERDHIGISLIIYLHFFNTKYTLRFIWYDQITLWIQETDMLYKGDTLYLDWLEDGIA
ELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAI
AVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPMTAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDIETPKQAAV
LGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPETVLASNTSTIPIGELAS
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLASVSQP
KRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTQ
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGSLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatctctgccgagcgtgatcacatcggcatttctttaatcatttatttgcattttttt
aacacaaaatacacacttcgcttcatctggtacgaccagatcactttgtggattcaggag
actgacatgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgcc
gaactggtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagc
ctcggccaggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgc
tctaataaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctc
gtccccgaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctg
gaagatttacccgtaccgacccttgccgccgtaaacggctatgcgctgggcggcgggtgc
gaatgcgtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccg
gaaactaaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctg
ggcgcagacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcg
ctgaaaatcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgata
gcggtgttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaa
ctggaaccgttgaaactcagtaagattgaagcagcgatgagctttaccatcgctaaaggc
atggtcgcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccatt
gaagccgccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgtt
ccgctggcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatat
gtaaaaggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgta
ctgggcgcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccg
gtcatcatgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaag
ctgctgaacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatt
tcgaccatccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaa
gcggtagtcgaaaatccgaaagtcaaaaaagcggtactggcggaaaccgagcagaaagtg
cgcccggaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagc
gccctggaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatg
ccgctggttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcgtc
gcctgggccagcaaaatgggcaagacaccgattgtagtcaacgactgccccggcttcttt
gttaaccgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcg
gatttccgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcc
tatctgctcgacgtggtgggtattgataccgcccaccacgcgcaggcagtaatggcggca
ggcttcccacagcgtatgcagaaagattaccgcgacgcgatcgacgcattgtttgacgcc
agccgttttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggt
aagccgaagaaagaagaagatgccgcggtggatgacctgctggcaagcgtcagccagccg
aaacgcgacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaa
gtggttcgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacag
ggcagcgcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgag
gtgccggaagggctgcgtaataaagcgcgccataacgaaccgtattatcccccggttgaa
ccagcccgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system