KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_4674Help
Entry
STM474_4674       CDS       T01760                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:seb00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:seb00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:seb03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:seb03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:seb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4740452..4740934)
Genome map
AA seq 160 aa AA seqDB search
MTTHLNPPQEAPYMKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEK
QAIRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFA
TAFTEVVDFVPYEETLKQLARERYKAYRVAGFNLNTATWK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcatttaaatccaccacaagaagccccatatatgaaaaatgcgacgttctat
cttctggataatgacaccaccgtcaacggtttaagcgccgttgaacaactggtgtgtgaa
attgccgcagaacgttggcgcgcgggcaagcgcgtgctgatcgcctgcgaagatgagaag
caggccattcggctggatgaagcgctgtgggcaagaccggcggaaagttttgtcccgcac
aatctggcaggcgaaggcccacgcggcggcgcgccggttgaaatcgcctggccgcaaaaa
cgcaacagcagcccgcgcgatattttaatcagcctgcgtacaagctttgcagattttgcc
accgctttcacagaagtggtagacttcgtcccttacgaagaaactttgaaacaactggcg
cgcgaacgctacaaagcctaccgcgtggctggttttaacctgaatacggcaacctggaaa
taa

DBGET integrated database retrieval system