KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_4773Help
Entry
STM474_4773       CDS       T01760                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:seb00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4842807..4844237
Genome map
AA seq 476 aa AA seqDB search
MALRLSGLQIQACRPDKALAAIRRCKPSTLFPQEGTVFLAQEIIRKKRDGHALSDEEIRF
FINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLNLNGPIVDK
HSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFRE
IIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVK
VGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLT
GEYRNPRLFDVTMALCVEMLISGQLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPS
DFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALGMAVVSMGGGRRQASDTIDYSVGFT
DMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAAIILDDKAPASTPSVYRRITE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgcttatccggcctacaaatccaggcctgtaggccggataaggcgttagcc
gccatccggcgatgtaagccttctactcttttccctcaggagggtaccgtgtttctcgca
caagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaagaaattcgtttc
tttattaatggtattcgtgacaatactatctctgaagggcagattgccgccctggcgatg
accatcttcttccacgatatgaccatgccggagcgtgtttcgctgaccatggcgatgcgg
gattccggtactgtccttgactggaaaagcctgaatctcaatggcccgattgtcgataag
cattcgaccggcggcgtaggggacgtgacgtctctgatgttggggccaatggtagcggcc
tgcggcggttatgtgccgatgatctccggtcgcggcctcggacataccggcggtacgctc
gacaaactggaagcgatcccgggcttcgatatcttcccggacgacaaccgtttccgcgaa
attattcaagacgtgggtgtggcgattattgggcaaaccagctcgcttgcaccggcggac
aaacgtttttacgccacccgcgatattaccgcgacggtggactctattccgctgatcacc
ggctccatcctcgccaagaaactggccgaagggcttgatgcgctggtaatggacgtaaaa
gtcggcagcggcgcgtttatgccaacctatgaactttctgaagcccttgctgaagcgatt
gtcggcgtggcaaatggcgcgggagttcgcactacggcgttgttaaccgatatgaaccag
gtgctggcttcaagcgccggtaacgcggtggaagtgcgtgaagccgtgcagttcctgacc
ggtgaataccgcaatccgcgcttgtttgacgtcactatggcgctatgcgtggagatgctg
atctccggccagctggcgaaagacgacgccgaagcgcgtgccaaactgcaggcggtgctg
gataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcagaaagggccaagc
gatttcgttgagaactacgataaatacttgccgaccgccatgttgagcaaagcggtatat
gctgataccgaagggtttatcagcgcaatggatacgcgtgcgctggggatggcggtcgtc
tcgatgggcggcggccgtcgtcaggcgtctgacaccattgattacagcgttggctttacc
gacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcggtgattcatgcc
aaagacgaagccagttggcaggaagcggcgaaggccgtcaaagcggcaattatccttgac
gataaagcgccagcaagcacaccttcggtctatcgtcgaattactgaatag

DBGET integrated database retrieval system